Overview

  • Product name

  • Description

    Rabbit polyclonal to CXCL9
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human CXCL9 aa 30-80 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    RCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDS A


    Database link: Q07325

  • Positive control

    • Human spleen and Mouse brain tissues

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 0.01% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab202961 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Use at 1/50 - 1/200 with fluorescent detection methods.

Target

  • Function

    Cytokine that affects the growth, movement, or activation state of cells that participate in immune and inflammatory response. Chemotactic for activated T-cells. Binds to CXCR3.
  • Sequence similarities

    Belongs to the intercrine alpha (chemokine CxC) family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • C-X-C motif chemokine 9 antibody
    • chemokine (C-X-C motif) ligand 9 antibody
    • CMK antibody
    • crg-10 antibody
    • CXCL9 antibody
    • CXCL9_HUMAN antibody
    • gamma interferon induced monokine antibody
    • Gamma-interferon-induced monokine antibody
    • HuMIG antibody
    • MIG antibody
    • monokine induced by gamma interferon antibody
    • monokine induced by interferon gamma antibody
    • Monokine induced by interferon-gamma antibody
    • SCYB9 antibody
    • Small inducible cytokine B9 antibody
    • small inducible cytokine subfamily B member 9 antibody
    • Small-inducible cytokine B9 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed and paraffin embedded Human spleen tissue labeling CXCL9 using ab202961 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed and paraffin embedded Mouse brain tissue labeling CXCL9 using ab202961 at 1/100 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab202961 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202961.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up