Overview

  • Product name

  • Description

    Rabbit polyclonal to CXX1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human CXX1 aa 1-113.
    Sequence:

    MDGRVQLIKALLALPIRPATRRWRNPIPFPETFDGDTDRLPEFIVQTGSY MFVDENTFSSDALKVTFLITRLTGPALQWVIPYIKKESPLLNDYRGFLAE MKRVFGWEEDEDF


    Database link: A6ZKI3

  • Positive control

    • WB: U-251 MG, PBMC and U-87 MG whole cell lysates. IHC-P: Human pancreatic cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab234988 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 13 kDa.
IHC-P 1/20 - 1/200.

Target

  • Relevance

    There seems to be two proteins that can be transcribed from FAM127A, one with a C terminal CAAX box (Swissprot id O15255) and a smaller protein (AC A6ZKI3) that seems to be encoded by a multicopy gene originating from a retrotransposon.
  • Cellular localization

    Cell membrane; Lipid anchor
  • Database links

  • Alternative names

    • CAAX box protein 1 antibody
    • Cerebral protein 5 antibody
    • CXX 1 antibody
    • FAM127A antibody
    • Family with sequence similarity 127, member A antibody
    • Mammalian retrotransposon derived protein 8C antibody
    • Mar8 antibody
    • MAR8C antibody
    • Mart8 antibody
    • MART8C antibody
    see all

Images

  • All lanes : Anti-CXX1 antibody (ab234988) at 1/500 dilution

    Lane 1 : U-251 MG (human brain glioma cell line) whole cell lysate
    Lane 2 : PBMC whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 13 kDa

  • Paraffin-embedded human pancreatic cancer tissue stained for CXX1 using ab234988 at 1/100 dilution in immunohistochemical analysis.

  • Anti-CXX1 antibody (ab234988) at 1/500 dilution + U-87 MG (human glioblastoma-astrocytoma epithelial cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 13 kDa

References

ab234988 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234988.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up