Overview

  • Product name

  • Description

    Rabbit polyclonal to CYB5B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human CYB5B aa 2-118.
    Sequence:

    ATAEASGSDGKGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRF LNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLK PESGSKDPSKNDTCKSC


    Database link: O43169

  • Positive control

    • WB: HepG2, U-87 MG, EC109 , HeLa and A549 whole cell lysates; mouse heart and liver lysates. IHC-P: Human kidney tissue. ICC/IF: HepG2 cells.
  • General notes

     This product was previously labelled as Cytochrome b5 Outer Mitochondrial Membrane

     

Properties

Applications

Our Abpromise guarantee covers the use of ab236612 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 16 kDa.
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.

Target

  • Relevance

    Cytochrome b5 Outer Mitochondrial Membrane belongs to the cytochrome b5 family and contains one cytochrome b5 heme-binding domain. Cytochrome b5 is a membrane bound hemoprotein which function as an electron carrier for several membrane bound oxygenases.
  • Cellular localization

    Mitochondrion outer membrane
  • Database links

  • Alternative names

    • CYB5 M antibody
    • CYB5M antibody
    • Cytochrome b5 type B antibody
    • OMB5 antibody
    • Type 2 cyt b5 antibody
    see all

Images

  • All lanes : Anti-CYB5B antibody (ab236612) at 1/500 dilution

    Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 2 : Mouse liver lysate
    Lane 3 : Mouse heart lysate
    Lane 4 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 5 : U-87 MG (human glioblastoma-astrocytoma epithelial cell line) whole cell lysate
    Lane 6 : EC109 whole cell lysate
    Lane 7 : A549 (human lung carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 16 kDa

  • Paraffin-embedded human kidney tissue stained for CYB5B using ab236612 at 1/100 dilution in immunohistochemical analysis.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for CYB5B (green) using ab236612 at 1/100 dilution in ICC/IF. Secondary antibody is Alexa Fluor® 488-congugated Goat Anti-Rabbit IgG (H+L).

References

ab236612 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236612.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up