Overview

  • Product name

  • Description

    Rabbit polyclonal to CYB5R2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human CYB5R2 aa 1-237.
    Sequence:

    MNSRRREPITLQDPEAKYPLPLIEKEKISHNTRRFRFGLPSPDHVLGLPV GNYVQLLAKIDNELVVRAYTPVSSDDDRGFVDLIIKIYFKNVHPQYPEGG KMTQYLENMKIGETIFFRGPRGRLFYHGPGNLGIRPDQTSEPKKTLADHL GMIAGGTGITPMLQLIRHITKDPSDRTRMSLIFANQTEEDILVRKELEEI ARTHPDQFNLWYTLDRPPIGPWSAEGATLLSNSAQFH


    Database link: Q6BCY4-2

  • Positive control

    • WB: Mouse kidney lysate. IHC-P: Human testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab237813 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 27, 31 kDa.

Target

  • Function

    NADH-cytochrome b5 reductases are involved in desaturation and elongation of fatty acids, cholesterol biosynthesis, drug metabolism, and, in erythrocyte, methemoglobin reduction (By similarity). Responsible for NADH-dependent lucigenin chemiluminescence in spermatozoa by reducing both lucigenin and 2-[4-iodophenyl]-3-[4-nitrophenyl]-5-[2,4-disulfophenyl]-2H tetrazolium monosodium salt (WST-1).
  • Tissue specificity

    Restricted expression.
  • Sequence similarities

    Belongs to the flavoprotein pyridine nucleotide cytochrome reductase family.
    Contains 1 FAD-binding FR-type domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • b5R.2 antibody
    • Cyb5r2 antibody
    • Cytochrome b5 reductase 2 antibody
    • Cytochrome b5 reductase b5R.2 antibody
    • NADH cytochrome b5 reductase 2 antibody
    • NADH-cytochrome b5 reductase 2 antibody
    • NB5R2_HUMAN antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for CYB5R2 using ab237813 at 1/100 dilution in immunohistochemical analysis.

  • Anti-CYB5R2 antibody (ab237813) at 1/1000 dilution + Mouse kidney lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 27, 31 kDa

References

ab237813 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237813.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up