Overview

  • Product name

  • Description

    Rabbit polyclonal to CYB5R3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow, Dog, Pig, Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human CYB5R3 aa 146-290.
    Sequence:

    SGLLVYQGKGKFAIRPDKKSNPIIRTVKSVGMIAGGTGITPMLQVIRAIM KDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLDRAPEA WDYGQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLDH


    Database link: P00387

  • Positive control

    • IHC-P: Human testis tissue. ICC/IF: A431 cells. WB: RT4, A431 and U-251 MG cell lysate. Human liver and tonsil tissue lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab244253 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB Use a concentration of 0.4 µg/ml. Predicted molecular weight: 34 kDa.

Target

  • Function

    Desaturation and elongation of fatty acids, cholesterol biosynthesis, drug metabolism, and, in erythrocyte, methemoglobin reduction.
  • Tissue specificity

    Isoform 2 is expressed at late stages of erythroid maturation.
  • Involvement in disease

    Defects in CYB5R3 are the cause of methemoglobinemia CYB5R3-related (METHB-CYB5R3) [MIM:250800]. A form of methemoglobinemia, a hematologic disease characterized by the presence of excessive amounts of methemoglobin in blood cells, resulting in decreased oxygen carrying capacity of the blood, cyanosis and hypoxia. There are two types of methemoglobinemia CYB5R3-related. In type 1, the defect affects the soluble form of the enzyme, is restricted to red blood cells, and causes well-tolerated methemoglobinemia. In type 2, the defect affects both the soluble and microsomal forms of the enzyme and is thus generalized, affecting red cells, leukocytes and all body tissues. Type 2 methemoglobinemia is associated with mental deficiency and other neurologic symptoms.
  • Sequence similarities

    Belongs to the flavoprotein pyridine nucleotide cytochrome reductase family.
    Contains 1 FAD-binding FR-type domain.
  • Cellular localization

    Endoplasmic reticulum membrane. Mitochondrion outer membrane and Cytoplasm. Produces the soluble form found in erythrocytes.
  • Information by UniProt
  • Database links

  • Alternative names

    • B5R antibody
    • Cyb5r3 antibody
    • Cytochrome b5 reductase 3 antibody
    • Cytochrome b5 reductase antibody
    • DIA1 antibody
    • Diaphorase 1 antibody
    • Diaphorase-1 antibody
    • NADH cytochrome b5 reductase 3 antibody
    • NADH-cytochrome b5 reductase 3 membrane-bound form antibody
    • NADH-cytochrome b5 reductase 3 soluble form antibody
    • NB5R3_HUMAN antibody
    • OTTHUMP00000028761 antibody
    • OTTHUMP00000198435 antibody
    • OTTHUMP00000198574 antibody
    • OTTHUMP00000198662 antibody
    • OTTHUMP00000198665 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human testis tissue stained for CYB5R3 with ab244253 at a 1/1000 dilution in immunohistochemical analysis.

  • PFA fixed, Triton X-100 permeabilized A431 (Human epidermoid carcinoma cell line) cells labeling CYB5R3 using ab244253 at 4 µg/ml (green) in ICC/IF.

  • All lanes : Anti-CYB5R3 antibody (ab244253) at 0.4 µg/ml

    Lane 1 : RT4 (Human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG (Human brain glioma cell line) cell lysate
    Lane 3 : A431 (Human epidermoid carcinoma cell line) cell lysate
    Lane 4 : Human liver tissue lysate
    Lane 5 : Human tonsil tissue lysate

    Predicted band size: 34 kDa

References

ab244253 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244253.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up