Overview

  • Product name

    Anti-CYB5R4/NCB5OR antibody
    See all CYB5R4/NCB5OR primary antibodies
  • Description

    Rabbit polyclonal to CYB5R4/NCB5OR
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CYB5R4/NCB5OR aa 420-513.
    Sequence:

    RKVKLMFFNKTEDDIIWRSQLEKLAFKDKRLDVEFVLSAPISEWNGKQGH ISPALLSEFLKRNLDKSKVLVCICGPVPFTEQGVRLLHDLNFSK


    Database link: Q7L1T6

  • Positive control

    • IHC-P: Human duodenum tissue. WB: RT4 cell lysate.
  • General notes

     This product was previously labelled as CYB5R4

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224412 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 59 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    NADH-cytochrome b5 reductase involved in endolasmic reticulum stress response pathway. Plays a critical role in protecting pancreatic beta-cells against oxidant stress, possibly by protecting the cell from excess buildup of reactive oxygen species (ROS). Reduces a variety of substrates in vitro, such as cytochrome c, feericyanide and methemoglobin.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Belongs to the flavoprotein pyridine nucleotide cytochrome reductase family.
    Contains 1 CS domain.
    Contains 1 cytochrome b5 heme-binding domain.
    Contains 1 FAD-binding FR-type domain.
  • Cellular localization

    Endoplasmic reticulum. Soluble protein.
  • Information by UniProt
  • Database links

  • Alternative names

    • b5+b5R antibody
    • b5b5r antibody
    • C79736 antibody
    • cb5/cb5R antibody
    • Cb5cb5r antibody
    • Cyb5r4 antibody
    • Cytochrome b type NAD(P)H oxidoreductase antibody
    • Cytochrome b5 reductase 4 antibody
    • dJ676J13.1 antibody
    • Flavohemoprotein b5+b5R antibody
    • Flavohemoprotein b5/b5R antibody
    • N terminal cytochrome b5 and cytochrome b5 oxidoreductase domain containing protein antibody
    • N-terminal cytochrome b5 and cytochrome b5 oxidoreductase domain-containing protein antibody
    • NADPH cytochrome B5 oxidoreductase antibody
    • NB5R4_HUMAN antibody
    • NCB5OR antibody
    • RP4 676J13.1 antibody
    see all

Images

  • Paraffin-embedded human duodenum tissue stained for CYB5R4/NCB5OR using ab224412 at 1/50 dilution in immunohistochemical analysis.

  • Anti-CYB5R4/NCB5OR antibody (ab224412) at 1/100 dilution + RT4 (human urinary bladder cancer cell line) cell lysate

    Predicted band size: 59 kDa

References

ab224412 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224412.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up