Overview

  • Product name

  • Description

    Rabbit polyclonal to CYC1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human CYC1 aa 181-322.
    Sequence:

    NSEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREG LYFNPYFPGQAIAMAPPIYTDVLEFDDGTPATMSQIAKDVCTFLRWASEP EHDHRKRMGLKMLMMMALLVPLVYTIKRHKWSVLKSRKLAYR


    Database link: P08574

  • Positive control

    • IHC: Human stomach tissue. WB: MCF7, NIH/3T3 and NBT-II cell lysate. ICC: U-251 MG cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224044 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 35 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    This is the heme-containing component of the cytochrome b-c1 complex, which accepts electrons from Rieske protein and transfers electrons to cytochrome c in the mitochondrial respiratory chain.
  • Sequence similarities

    Belongs to the cytochrome c family.
    Contains 1 cytochrome c domain.
  • Post-translational
    modifications

    Binds 1 heme group per subunit.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Complex III subunit 4 antibody
    • Complex III subunit IV antibody
    • CY1_HUMAN antibody
    • CYC1 antibody
    • Cytochrome b c1 complex subunit 4 antibody
    • Cytochrome b-c1 complex subunit 4 antibody
    • Cytochrome bc1 complex subunit 4 antibody
    • Cytochrome c 1 antibody
    • Cytochrome c-1 antibody
    • Cytochrome c1, heme protein, mitochondrial antibody
    • Ubiquinol cytochrome c reductase complex cytochrome c1 subunit antibody
    • Ubiquinol-cytochrome-c reductase complex cytochrome c1 subunit antibody
    • UQCR4 antibody
    see all

Images

  • Immunohistochemistry analysis of human skeletal tissue labelling CYC1 with ab224044 at 1/200.

  • Immunohistochemistry analysis of human kidney tissue labelling CYC1 with ab224044 at 1/200.

  • Immunohistochemistry analysis of human duodenum tissue labelling CYC1 with ab224044 at 1/200.

  • Immunohistochemistry analysis of human cerebral cortex tissue labelling CYC1 with ab224044 at 1/200.

  • Anti-CYC1 antibody (ab224044) at 1/100 dilution + MCF7 (human breast adenocarcinoma cell line) cell lysate

    Predicted band size: 35 kDa

  • PFA-fixed, Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for CYC1 (green) using ab224044 at 4 µg/ml in ICC/IF.

References

This product has been referenced in:

  • Lu T  et al. Long non-coding RNA C5orf66-AS1 prevents oral squamous cell carcinoma through inhibiting cell growth and metastasis. Int J Mol Med 42:3291-3299 (2018). Read more (PubMed: 30280186) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224044.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up