Overview

  • Product name

  • Description

    Rabbit polyclonal to Cyclin A1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human Cyclin A1 aa 166-465. (With tag; BC036346).
    Sequence:

    TGTLKSDLHFLLDFNTVSPMLVDSSLLSQSEDISSLGTDVINVTEYAEEI YQYLREAEIRHRPKAHYMKKQPDITEGMRTILVDWLVEVGEEYKLRAETL YLAVNFLDRFLSCMSVLRGKLQLVGTAAMLLASKYEEIYPPEVDEFVYIT DDTYTKRQLLKMEHLLLKVLAFDLTVPTTNQFLLQYLRRQGVCVRTENLA KYVAELSLLEADPFLKYLPSLIAAAAFCLANYTVNKHFWPETLAAFTGYS LSEIVPCLSELHKAYLDIPHRPQQAIREKYKASKYLCVSLMEPPAVLLLQ


    Database link: P78396

Properties

Applications

Our Abpromise guarantee covers the use of ab182665 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 52 kDa.

Target

  • Function

    May be involved in the control of the cell cycle at the G1/S (start) and G2/M (mitosis) transitions. May primarily function in the control of the germline meiotic cell cycle and additionally in the control of mitotic cell cycle in some somatic cells.
  • Tissue specificity

    Very high levels in testis and very low levels in brain. Also found in myeloid Leukemia cell lines.
  • Sequence similarities

    Belongs to the cyclin family. Cyclin AB subfamily.
  • Developmental stage

    Expression increases in early G1 phase and reaches highest levels during the S and G2/M phases.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • CCN A1 antibody
    • CCNA 1 antibody
    • Ccna1 antibody
    • CCNA1_HUMAN antibody
    • Cyclin-A1 antibody
    • CyclinA1 antibody
    • G2/mitotic specific cyclin A1 antibody
    • MGC132235 antibody
    • MGC159139 antibody
    see all

Images

  • Anti-Cyclin A1 antibody (ab182665) at 1/500 dilution + Human breast invasive ductal carcinoma tissue at 40 µg

    Secondary
    Goat anti Rabbit IgG - H&L (HRP) at 1/10000 dilution

    Developed using the ECL technique.

    Predicted band size: 52 kDa


    Exposure time: 30 seconds


    Gel: 8% SDS-PAGE

References

ab182665 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182665.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up