Anti-Cyclin antibody (ab243736)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-Cyclin antibody
See all Cyclin primary antibodies -
Description
Rabbit polyclonal to Cyclin -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse
-
Immunogen
Recombinant fragment corresponding to Human Cyclin aa 261-346.
Sequence:VYRPLKHTLVTCDKGVFRLHPSSVPGPDFSKDNSKPEVPVRGTAAFYHHL PAASGCKQTSTKRKVEEMEVDDFYDGIKRLYNEDNV
Database link: Q14094 -
Positive control
- IHC-P: Human testis tissue. ICC/IF: U-2 OS cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab243736 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100 |
Target
-
Relevance
The cell cycle is regulated by the interplay of many molecules. Key among these are the cyclins which are expressed and then degraded in a concerted fashion to drive the stages of the cell cycle. Cyclins combine with cyclin dependent kinases (cdks) to form activated kinases that phosphorylate targets leading to cell cycle regulation. A breakdown in the regulation of this cycle can lead to out of control growth and contribute to tumor formation. Defects in many of the molecules that regulate the cell cycle have been implicated in cancer -
Database links
- Entrez Gene: 10983 Human
- Entrez Gene: 12453 Mouse
- SwissProt: Q14094 Human
- SwissProt: Q9Z2V9 Mouse
- Unigene: 518827 Human
- Unigene: 250419 Mouse
-
Alternative names
- CCNI antibody
- CYC1 antibody
- Cyclin 1 antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-Cyclin antibody (ab243736)PFA fixed, Triton X-100 permeabilized U-2 OS (Human bone osteosarcoma epithelial cell line) cells labeling Cyclin using ab243736 at 4 µg/ml (green) in ICC/IF.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Cyclin antibody (ab243736)Formalin-fixed, paraffin-embedded human testis tissue stained for Cyclin with ab243736 at a 1/50 dilution in immunohistochemical analysis.
Datasheets and documents
References
ab243736 has not yet been referenced specifically in any publications.
