Overview

  • Product name

  • Description

    Rabbit polyclonal to Cyclin B1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, Flow Cyt, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Synthetic peptide within Mouse Cyclin B1 aa 380-420 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    LAKNVVMVNCGLTKHMTVKNKYAASKHAKISTLAQLNCTLV


    Database link: P24860

  • Positive control

    • Human colon carcinoma tissue; HeLa cells; HeLa, U937, U251 and K562 cell lysates; HEK293 and MCF-7 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab215436 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 48 kDa.
IHC-P 1/100 - 1/500.
Flow Cyt 1/20 - 1/100.
ICC/IF 1/50 - 1/200.

Target

Images

  • Anti-Cyclin B1 antibody (ab215436) at 1/100 dilution + HeLa cell lysates

    Predicted band size: 48 kDa

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human colon carcinoma tissue labeling Cyclin B1 with ab215436 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining

  • Flow cytometric analysis of HeLa cells labeling Cyclin B1 with ab215436 at 1/100 dilution for 60 minutes at room temperature, followed by incubation with a Goat Anti-Rabbit IgG (H+L) Alexa Fluor 488 conjugated secondary antibody.

  • Anti-Cyclin B1 antibody (ab215436) at 1/100 dilution + U937 cell lysates

    Predicted band size: 48 kDa

  • Anti-Cyclin B1 antibody (ab215436) at 1/100 dilution + U251 cell lysates

    Predicted band size: 48 kDa

  • Anti-Cyclin B1 antibody (ab215436) at 1/100 dilution + K562 cell lysates

    Predicted band size: 48 kDa

References

ab215436 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215436.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up