Overview

  • Product name

    Anti-Cyclin B1 antibody [CCNB1/1098]
    See all Cyclin B1 primary antibodies
  • Description

    Mouse monoclonal [CCNB1/1098] to Cyclin B1
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Chinese hamster
  • Immunogen

    Recombinant full length protein corresponding to Human Cyclin B1 aa 1-433.
    Sequence:

    MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGN KVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPE PEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVI LAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVRPKYLLGREVTGN MRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVT AMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRP LPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFC LALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTV KNKYATSKHAKISTLPQLNSALVQDLAKAVAKV


    Database link: P14635

  • Positive control

    • Human tonsil, testicular carcinoma, endometrial carcinoma, prostate carcinoma and ovarian carcinoma tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab212977 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

(Primary incubation for 30 minutes at RT).

Target

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human tonsil tissue labeling Cyclin B1 with ab212977 at 1 µg/ml.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human testicular carcinoma tissue labeling Cyclin B1 with ab212977 at 1 µg/ml.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human endometrial carcinoma tissue labeling Cyclin B1 with ab212977 at 1 µg/ml.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human prostate carcinoma tissue labeling Cyclin B1 with ab212977 at 1 µg/ml.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human ovarian carcinoma tissue labeling Cyclin B1 with ab212977 at 1 µg/ml.

References

ab212977 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab212977.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up