Overview

  • Product name

  • Description

    Rabbit polyclonal to Cyclin B3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Cyclin B3 aa 234-344.
    Sequence:

    KMCASQRKQSCQEESLAVQDVNMEEDSFFMESMSFKKKPKTEESIPTHKL SSLKKKCTIYGKICHFRKPPVLQTTICGAMSSIKKPTTEKETLFQELSVL QEKHTTEHEMS


    Database link: Q8WWL7

  • Positive control

    • IHC-P: Human testis tissue. ICC/IF: A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab223715 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    Cyclin B3 belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event.This cyclin may associate with CDC2 and CDK2 kinases, and be required for proper spindle reorganization and restoration of the interphase nucleus.
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • CCNB 3 antibody
    • CYCB3 antibody
    • G2/mitotic specific cyclin B3 antibody

Images

  • Paraffin embedded sections of human testis were stained for Cyclin B3 with ab223715 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin embedded sections of human liver were stained for Cyclin B3 with ab223715 at 1/200 dilution in immunohistochemical analysis.

    Note: this is a negative control.

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for Cyclin B3 (green) using ab223715 at 4 µg/ml in ICC/IF.

References

ab223715 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223715.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up