Overview

  • Product name

  • Description

    Rabbit polyclonal to Cyclin D2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken, Cow, Pig, Xenopus laevis
  • Immunogen

    Recombinant fragment corresponding to Human Cyclin D2 aa 15-62. Numbering is from isoform 1; the sequence also occurs in isoform 2.
    Sequence:

    VRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATW


    Database link: P30279

  • Positive control

    • CACO-2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220732 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Regulatory component of the cyclin D2-CDK4 (DC) complex that phosphorylates and inhibits members of the retinoblastoma (RB) protein family including RB1 and regulates the cell-cycle during G(1)/S transition. Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complex and the subsequent transcription of E2F target genes which are responsible for the progression through the G(1) phase. Hypophosphorylates RB1 in early G(1) phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals. Also substrate for SMAD3, phosphorylating SMAD3 in a cell-cycle-dependent manner and repressing its transcriptional activity. Component of the ternary complex, cyclin D2/CDK4/CDKN1B, required for nuclear translocation and activity of the cyclin D-CDK4 complex.
  • Sequence similarities

    Belongs to the cyclin family. Cyclin D subfamily.
    Contains 1 cyclin N-terminal domain.
  • Cellular localization

    Nucleus. Cytoplasm. Membrane. Cyclin D-CDK4 complexes accumulate at the nuclear membrane and are then translocated into the nucleus through interaction with KIP/CIP family members.
  • Information by UniProt
  • Database links

  • Alternative names

    • CCND 2 antibody
    • ccnd2 antibody
    • CCND2_HUMAN antibody
    • CyclinD2 antibody
    • G1/S specific cyclin D2 antibody
    • G1/S-specific cyclin-D2 antibody
    • KIAK0002 antibody
    • MGC102758 antibody
    • MPPH3 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized CACO-2 cells labeling Cyclin D2 with ab220732 at 4 µg/ml.  Antibody staining is shown in green.  

References

ab220732 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220732.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up