Overview

  • Product name

    Anti-Cyclin E1 antibody [5F8C5]
    See all Cyclin E1 primary antibodies
  • Description

    Mouse monoclonal [5F8C5] to Cyclin E1
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, Flow Cytmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human Cyclin E1 aa 307-410.
    Sequence:

    FSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADED AHNIQTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSGKKQSSG PEMA


    Database link: P24864

  • Positive control

    • Cyclin E1 (AA: 307-410) recombinant protein; Cyclin E1 (AA: 307-410)-hIgGFc transfected HEK293 cell lysate; HeLa, K562, NIH3T3, C6, MCF7, Jurkat and A431 cell lysates; K562 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab211342 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 47 kDa.
Flow Cyt 1/200 - 1/400.

Target

  • Function

    Essential for the control of the cell cycle at the G1/S (start) transition.
  • Tissue specificity

    Highly expressed in testis and placenta. Low levels in bronchial epithelial cells.
  • Sequence similarities

    Belongs to the cyclin family. Cyclin E subfamily.
  • Post-translational
    modifications

    Phosphorylation of Thr-395 by GSK3 and of Ser-399 by CDK2 accelerates degradation via the ubiquitin proteasome pathway. Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • CCNE antibody
    • Ccne1 antibody
    • CCNE1_HUMAN antibody
    • cyclin E variant ex5del antibody
    • cyclin E variant ex7del antibody
    • Cyclin E1 antibody
    • Cyclin Es antibody
    • Cyclin Et antibody
    • CyclinE antibody
    • G1/S specific cyclin E antibody
    • G1/S-specific cyclin-E1 antibody
    see all

Images

  • Flow Cytometrical analysis of K562 cells labeling Cyclin E1 with ab211342 at 1/200 (green) compared to a negative control (red).

  • All lanes : Anti-Cyclin E1 antibody [5F8C5] (ab211342) at 1/500 dilution

    Lane 1 : HeLa cell lysates
    Lane 2 : K562 cell lysates
    Lane 3 : NIH3T3 cell lysates
    Lane 4 : C6 cell lysates
    Lane 5 : MCF7 cell lysates
    Lane 6 : Jurkat cell lysates
    Lane 7 : A431 cell lysates

    Predicted band size: 47 kDa

  • All lanes : Anti-Cyclin E1 antibody [5F8C5] (ab211342) at 1/500 dilution

    Lane 1 : HEK293 cell lysate
    Lane 2 : Cyclin E1 (AA: 307-410)-hIgGFc transfected HEK293 cell lysate

    Predicted band size: 47 kDa

  • Anti-Cyclin E1 antibody [5F8C5] (ab211342) at 1/500 dilution + human Cyclin E1 (AA: 307-410) recombinant protein

    Predicted band size: 47 kDa
    Observed band size: 37.5 kDa
    why is the actual band size different from the predicted?

References

ab211342 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab211342.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up