Anti-Cyclin E2 antibody (ab236106)
- Datasheet
- References (1)
- Protocols
Overview
-
Product name
Anti-Cyclin E2 antibody
See all Cyclin E2 primary antibodies -
Description
Rabbit polyclonal to Cyclin E2 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Cow
-
Immunogen
Recombinant fragment corresponding to Human Cyclin E2 aa 255-404.
Sequence:ALKDAPKVLLPQYSQETFIQIAQLLDLCILAIDSLEFQYRILTAAALCHF TSIEVVKKASGLEWDSISECVDWMVPFVNVVKSTSPVKLKTFKKIPMEDR HNIQTHTNYLAMLEEVNYINTFRKGGQLSPVCNGGIMTPPKSTEKPPGKH
Database link: O96020 -
Positive control
- IHC-P: Human testis and thyroid tissues.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab236106 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/20 - 1/200. |
Target
-
Relevance
The human Cyclin E2 gene encodes a 404 amino acid protein that is most closely related to Cyclin E. Cyclin E2 mRNA levels peaks at the G1 / S transition. Cyclin E2 associates with Cdk2 in a functional kinase complex that is inhibited by both p27 (Kip1) and p21 (Cip1). Cyclin E2 / Cdk2 phosphorylates histone H1 in vitro. G1 cyclin E controls the initiation of DNA synthesis by activating CDK2. Abnormally high levels of cyclin E expression have frequently been observed in human cancers. Unlike Cyclin E1, which is expressed in great majority of proliferating normal and neoplastically transformed cells, Cyclin E2 levels are low to undetectable in non transformed cells and increase significantly in neoplasm derived cells. -
Cellular localization
Nuclear -
Database links
- Entrez Gene: 538436 Cow
- Entrez Gene: 9134 Human
- Entrez Gene: 12448 Mouse
- Omim: 603775 Human
- SwissProt: Q5E9K7 Cow
- SwissProt: O96020 Human
- SwissProt: Q7TMS8 Mouse
- SwissProt: Q9Z238 Mouse
see all -
Alternative names
- CCN E2 antibody
- CCNE 2 antibody
- CCNE2 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Cyclin E2 antibody (ab236106)Paraffin-embedded human testis tissue stained for Cyclin E2 using ab236106 at 1/100 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Cyclin E2 antibody (ab236106)Paraffin-embedded human thyroid tissue stained for Cyclin E2 using ab236106 at 1/100 dilution in immunohistochemical analysis.
Datasheets and documents
References
This product has been referenced in:
- Xie Q et al. miR-3687 Overexpression Promotes Bladder Cancer Cell Growth by Inhibiting the Negative Effect of FOXP1 on Cyclin E2 Transcription. Mol Ther 27:1028-1038 (2019). Read more (PubMed: 30935821) »
