Overview

  • Product name

  • Description

    Rabbit polyclonal to Cyclin T1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, IP, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide within Human Cyclin T1 aa 625-675. The exact sequence is proprietary.
    Sequence:

    FSQPSCKTRVPHSKLDKGPTGANGHNTTQTIDYQDTVNMLHSLLSAQGVQ P


    Database link: O60563

  • Positive control

    • HeLa and 293T whole cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab176702 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use at an assay dependent concentration.
IP Use at 2-10 µg/mg of lysate.
WB 1/2000 - 1/10000. Predicted molecular weight: 81 kDa.

Target

  • Function

    Regulatory subunit of the cyclin-dependent kinase pair (CDK9/cyclin-T1) complex, also called positive transcription elongation factor B (P-TEFb), which is proposed to facilitate the transition from abortive to productive elongation by phosphorylating the CTD (carboxy-terminal domain) of the large subunit of RNA polymerase II (RNA Pol II). In case of HIV or SIV infections, binds to the transactivation domain of the viral nuclear transcriptional activator, Tat, thereby increasing Tat's affinity for the transactivating response RNA element (TAR RNA). Serves as an essential cofactor for Tat, by promoting RNA Pol II activation, allowing transcription of viral genes.
  • Tissue specificity

    Ubiquitously expressed.
  • Sequence similarities

    Belongs to the cyclin family. Cyclin C subfamily.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • CCN T1 antibody
    • CCNT antibody
    • CCNT 1 antibody
    • Ccnt1 antibody
    • CCNT1_HUMAN antibody
    • CDK9 associated C type protein antibody
    • Cyc T1 antibody
    • Cyclin C related protein antibody
    • Cyclin T antibody
    • cyclin T1 antibody
    • Cyclin T1b antibody
    • Cyclin-T antibody
    • Cyclin-T1 antibody
    • CYCT 1 antibody
    • CycT1 antibody
    • HIVE1 antibody
    • Human immunodeficiency virus 1 expression antibody
    • Human immunodeficiency virus type 1 (HIV 1) expression (elevated) 1 antibody
    • pTEFb subunit antibody
    • Subunit of positive elongation transcription factor b antibody
    see all

Images

  • All lanes : Anti-Cyclin T1 antibody (ab176702) at 0.04 µg/ml

    Lane 1 : HeLa whole cell lysate at 50 µg
    Lane 2 : HeLa whole cell lysate at 15 µg
    Lane 3 : 293T whole cell lysate at 50 µg

    Predicted band size: 81 kDa


    Exposure time: 3 minutes
  • Detection of Cyclin T1 by Western Blot of Immunprecipitate.


    Lane 1: ab176702 at 0.04µg/ml labeling Cyclin T1 in HeLa whole cell lysate immunoprecipitated using ab176702 at 6µg/mg lysate (1 mg/IP; 20% of IP loaded/lane). Lane 2: Control IgG
    Detection: Chemiluminescence with exposure time of 3 seconds.

     

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176702.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up