Anti-CYP11A1 antibody (ab175408)
Key features and details
- Rabbit polyclonal to CYP11A1
- Suitable for: IHC-P, WB
- Reacts with: Mouse, Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-CYP11A1 antibody
See all CYP11A1 primary antibodies -
Description
Rabbit polyclonal to CYP11A1 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Mouse, Rat, Human
Predicted to work with: Cynomolgus monkey -
Immunogen
Recombinant full length protein corresponding to Human CYP11A1 aa 40-320.
Sequence:MLAKGLPPRSVLVKGCQTFLSAPREGLGRLRVPTGEGAGISTRSPRPFNE IPSPGDNGWLNLYHFWRETGTHKVHLHHVQNFQKYGPIYREKLGNVESVY VIDPEDVALLFKSEGPNPERFLIPPWVAYHQYYQRPIGVLLKKSAAWKKD RVALNQEVMAPEATKNFLPLLDAVSRDFVSVLHRRIKKAGSGNYSGDISD DLFRFAFESITNVIFGERQGMLEEVVNPEAQRFIDAIYQMFHTSVPMLNL PPDLFRLFRTKTWKDHVAAWDVIFSKADIYTQNFYWELRQKGSVHHDYRG ILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQWHLYEMARNLKVQD MLRAEVLAARHQAQGDMATMLQLVPLLKASIKETLRLHPISVTLQRYLVN DLVLRDYMIPAKTLVQVAIYALGREPTFFFDPENFDPTRWLSKDKNITYF RNLGFGWGVRQCLGRRIAELEMTIFLINMLENFRVEIQHLSDVGTTFNLI LMPEKPISFTFWPFNQEATQQ
Database link: P05108 -
Positive control
- WB: Mouse testis, rat ovary; IHC-P: human placenta.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 49% PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
- Metabolism
- Pathways and Processes
- Metabolic signaling pathways
- Lipid and lipoprotein metabolism
- Lipid metabolism
- Metabolism
- Pathways and Processes
- Metabolic signaling pathways
- Lipid and lipoprotein metabolism
- Cholesterol Metabolism
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab175408 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P |
1/50 - 1/200.
ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody. |
|
WB |
1/500 - 1/2000. Predicted molecular weight: 60 kDa.
|
Notes |
---|
IHC-P
1/50 - 1/200. ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody. |
WB
1/500 - 1/2000. Predicted molecular weight: 60 kDa. |
Target
-
Function
Catalyzes the side-chain cleavage reaction of cholesterol to pregnenolone. -
Pathway
Lipid metabolism; C21-steroid hormone metabolism. -
Involvement in disease
Defects in CYP11A1 are a cause of congenital adrenal insufficiency (CAI).
Defects in CYP11A1 are a cause of congenital lipoid adrenal hyperplasia (CLAH) [MIM:201710]; also known as lipoid CAH. CLAH is the most severe form of adrenal hyperplasia. This autosomal recessive and potentially lethal condition includes the onset of profound adrenocortical insufficiency shortly after birth, hyperpigmentation reflecting increased production of pro-opiomelanocortin, elevated plasma renin activity as a consequence of reduced aldosterone synthesis, and male pseudohermaphroditism resulting from deficient fetal testicular testosterone synthesis. CLAH is a rare disease, except in Japan and Korea where it accounts for a significant percentage of cases of congenital adrenal hyperplasia. -
Sequence similarities
Belongs to the cytochrome P450 family. -
Cellular localization
Mitochondrion membrane. - Information by UniProt
-
Database links
- Entrez Gene: 102120640 Cynomolgus monkey
- Entrez Gene: 1583 Human
- Entrez Gene: 13070 Mouse
- Entrez Gene: 29680 Rat
- Omim: 118485 Human
- SwissProt: Q2XV99 Cynomolgus monkey
- SwissProt: P05108 Human
- SwissProt: Q9QZ82 Mouse
see all -
Alternative names
- Cholesterol 20 22 desmolase antibody
- Cholesterol desmolase antibody
- Cholesterol monooxygenase (side chain cleaving) antibody
see all
Images
-
Paraffin-embedded human placenta tissue stained for CYP11A1 using ab175408 at 1/150 dilution in immunohistochemical analysis.
-
All lanes : Anti-CYP11A1 antibody (ab175408) at 1/1000 dilution
Lane 1 : Mouse testis
Lane 2 : Rat ovary
Lysates/proteins at 25 µg per lane.
Secondary
All lanes : HRP Goat Anti-Rabbit IgG
Developed using the ECL technique.
Predicted band size: 60 kDa
Exposure time: 10 secondsBlocking buffer: 3% nonfat dry milk in TBST.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (25)
ab175408 has been referenced in 25 publications.
- Gudelska M et al. Chemerin Affects P4 and E2 Synthesis in the Porcine Endometrium during Early Pregnancy. Int J Mol Sci 23:N/A (2022). PubMed: 35055130
- Jeminiwa BO et al. Gonadal sex steroid hormone secretion after exposure of male rats to estrogenic chemicals and their combinations. Mol Cell Endocrinol 533:111332 (2021). PubMed: 34038751
- Khan A et al. SOD1 Gene Silencing Promotes Apoptosis and Suppresses Proliferation of Heat-Stressed Bovine Granulosa Cells via Induction of Oxidative Stress. Vet Sci 8:N/A (2021). PubMed: 34941853
- Wang J et al. H2 S catalysed by CBS regulates testosterone synthesis through affecting the sulfhydrylation of PDE. J Cell Mol Med 25:3460-3468 (2021). PubMed: 33713531
- Yi X et al. Effect of Different Exercise Loads on Testicular Oxidative Stress and Reproductive Function in Obese Male Mice. Oxid Med Cell Longev 2020:3071658 (2020). PubMed: 32082477