Overview

  • Product name

  • Description

    Rabbit polyclonal to CYP11A1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Recombinant full length protein corresponding to Human CYP11A1 aa 1-521.
    Sequence:

    MLAKGLPPRSVLVKGCQTFLSAPREGLGRLRVPTGEGAGISTRSPRPFNE IPSPGDNGWLNLYHFWRETGTHKVHLHHVQNFQKYGPIYREKLGNVESVY VIDPEDVALLFKSEGPNPERFLIPPWVAYHQYYQRPIGVLLKKSAAWKKD RVALNQEVMAPEATKNFLPLLDAVSRDFVSVLHRRIKKAGSGNYSGDISD DLFRFAFESITNVIFGERQGMLEEVVNPEAQRFIDAIYQMFHTSVPMLNL PPDLFRLFRTKTWKDHVAAWDVIFSKADIYTQNFYWELRQKGSVHHDYRG ILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQWHLYEMARNLKVQD MLRAEVLAARHQAQGDMATMLQLVPLLKASIKETLRLHPISVTLQRYLVN DLVLRDYMIPAKTLVQVAIYALGREPTFFFDPENFDPTRWLSKDKNITYF RNLGFGWGVRQCLGRRIAELEMTIFLINMLENFRVEIQHLSDVGTTFNLI LMPEKPISFTFWPFNQEATQQ


    Database link: P05108

  • Positive control

    • WB: Mouse testis, rat ovary; IHC-P: human placenta.

Applications

Our Abpromise guarantee covers the use of ab175408 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

WB 1/500 - 1/2000. Predicted molecular weight: 60 kDa.

Target

  • Function

    Catalyzes the side-chain cleavage reaction of cholesterol to pregnenolone.
  • Pathway

    Lipid metabolism; C21-steroid hormone metabolism.
  • Involvement in disease

    Defects in CYP11A1 are a cause of congenital adrenal insufficiency (CAI).
    Defects in CYP11A1 are a cause of congenital lipoid adrenal hyperplasia (CLAH) [MIM:201710]; also known as lipoid CAH. CLAH is the most severe form of adrenal hyperplasia. This autosomal recessive and potentially lethal condition includes the onset of profound adrenocortical insufficiency shortly after birth, hyperpigmentation reflecting increased production of pro-opiomelanocortin, elevated plasma renin activity as a consequence of reduced aldosterone synthesis, and male pseudohermaphroditism resulting from deficient fetal testicular testosterone synthesis. CLAH is a rare disease, except in Japan and Korea where it accounts for a significant percentage of cases of congenital adrenal hyperplasia.
  • Sequence similarities

    Belongs to the cytochrome P450 family.
  • Cellular localization

    Mitochondrion membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cholesterol 20 22 desmolase antibody
    • Cholesterol desmolase antibody
    • Cholesterol monooxygenase (side chain cleaving) antibody
    • Cholesterol side chain cleavage enzyme antibody
    • Cholesterol side chain cleavage enzyme mitochondrial antibody
    • Cholesterol side-chain cleavage enzyme antibody
    • CP11A_HUMAN antibody
    • CYP11A antibody
    • CYP11A1 antibody
    • CYPXIA1 antibody
    • Cytochrome P450 11A1 antibody
    • Cytochrome P450 11A1 mitochondrial antibody
    • Cytochrome P450 family 11 subfamily A polypeptide 1 antibody
    • Cytochrome P450 subfamily XIA antibody
    • Cytochrome P450(scc) antibody
    • Cytochrome P450C11A1 antibody
    • mitochondrial antibody
    • P450SCC antibody
    • Steroid 20 22 lyase antibody
    see all

Images

  • Paraffin-embedded human placenta tissue stained for CYP11A1 using ab175408 at 1/150 dilution in immunohistochemical analysis. 

  • All lanes : Anti-CYP11A1 antibody (ab175408) at 1/1000 dilution

    Lane 1 : Mouse testis
    Lane 2 : Rat ovary

    Lysates/proteins at 25 µg per lane.

    Secondary
    All lanes : HRP Goat Anti-Rabbit IgG

    Developed using the ECL technique.

    Predicted band size: 60 kDa


    Exposure time: 10 seconds

References

This product has been referenced in:

  • Savchuk I  et al. Ontogenesis of human fetal testicular steroidogenesis at early gestational age. Steroids 141:96-103 (2019). Read more (PubMed: 30529237) »
  • Prasad SK  et al. Radioprotective effect of ethanolic extract of Alocasia indica on ?-irradiation-induced reproductive alterations in ovary and uterus. Int J Radiat Biol N/A:1-14 (2019). Read more (PubMed: 31314632) »
See all 13 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175408.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up