Anti-CYP11B1 antibody (ab171888)
Key features and details
- Rabbit polyclonal to CYP11B1
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-CYP11B1 antibody
See all CYP11B1 primary antibodies -
Description
Rabbit polyclonal to CYP11B1 -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Full length protein corresponding to Human CYP11B1 aa 1-574. Protein Accession number AAH96285.1.
Sequence:MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWL RLLQIWREQGYEDLHLEVHQTFQELGPIFRSRHSASFGRWGRSAARAGLW RCQGRGWCRANPSSLQRGQDSEALKYDLGGAGMVCVMLPEDVEKLQQVDS LHPHRMSLEPWVAYRQHRGHKCGVFLLNVADRGNSSPPFPGGIHGAPTHS GCRNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQN ARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEV MFKSTVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELA FSRPQQYTSIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPLLMTLFE LARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVG LFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRPERYNPQRWL DIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQE DIKMVYSFILRPSMFPLLTFRAIN
Database link: AAH96285.1 -
Positive control
- CYP11B1 transfected 293T cell line.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Constituent: 100% PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab171888 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 1 µg/ml. Predicted molecular weight: 57 kDa. |
Target
-
Relevance
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the mitochondrial inner membrane and has steroid 11-beta-hydroxylase activity. In addition to this activity, the 18 or 19-hydroxylation of steroids and the aromatization of androstendione to estrone have also been ascribed to cytochrome P450 XIB. Defects in CYP11B1 are the cause of adrenal hyperplasia type 4 (AH4) [MIM:202010]. AH4 is a form of congenital adrenal hyperplasia, a common recessive disease due to defective synthesis of cortisol. Congenital adrenal hyperplasia is characterized by androgen excess leading to ambiguous genitalia in affected females, rapid somatic growth during childhood in both sexes with premature closure of the epiphyses and short adult stature. Four clinical types: "salt wasting" (SW, the most severe type), "simple virilizing" (SV, less severely affected patients), with normal aldosterone biosynthesis, "non-classic form" or late onset (NC or LOAH), and "cryptic" (asymptomatic). AH4 patients usually have hypertension. -
Cellular localization
Mitochondrion inner membrane. -
Database links
- Entrez Gene: 1584 Human
- Omim: 610613 Human
- SwissProt: P15538 Human
- Unigene: 184927 Human
-
Alternative names
- CPN1 antibody
- CYP11B antibody
- CYPXIB1 antibody
see all
Images
-
All lanes : Anti-CYP11B1 antibody (ab171888) at 1 µg/ml
Lane 1 : CYP11B1 transfected 293T cell lysate
Lane 2 : Non- transfected 293T cell lysate
Secondary
All lanes : Goat Anti-Mouse IgG (H&L)-HRP at 1/2500 dilution
Developed using the ECL technique.
Predicted band size: 57 kDa
Datasheets and documents
References (0)
ab171888 has not yet been referenced specifically in any publications.