Overview

  • Product name

  • Description

    Rabbit polyclonal to CYP11B1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CYP11B1 aa 88-323.
    Sequence:

    MVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYRQHRGHKCGVFLLNGPEW RFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLD VQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQL MFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYT SIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPL


    Database link: P15538

  • Positive control

    • WB: Mouse heart and kidney tissue lysates.

Applications

Our Abpromise guarantee covers the use of ab229884 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Detects a band of approximately 58 kDa (predicted molecular weight: 58, 50 kDa).

Target

  • Relevance

    This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the mitochondrial inner membrane and has steroid 11-beta-hydroxylase activity. In addition to this activity, the 18 or 19-hydroxylation of steroids and the aromatization of androstendione to estrone have also been ascribed to cytochrome P450 XIB. Defects in CYP11B1 are the cause of adrenal hyperplasia type 4 (AH4) [MIM:202010]. AH4 is a form of congenital adrenal hyperplasia, a common recessive disease due to defective synthesis of cortisol. Congenital adrenal hyperplasia is characterized by androgen excess leading to ambiguous genitalia in affected females, rapid somatic growth during childhood in both sexes with premature closure of the epiphyses and short adult stature. Four clinical types: "salt wasting" (SW, the most severe type), "simple virilizing" (SV, less severely affected patients), with normal aldosterone biosynthesis, "non-classic form" or late onset (NC or LOAH), and "cryptic" (asymptomatic). AH4 patients usually have hypertension.
  • Cellular localization

    Mitochondrion inner membrane.
  • Database links

  • Alternative names

    • CPN1 antibody
    • CYP11B antibody
    • CYPXIB1 antibody
    • Cytochrome P 450c11 antibody
    • Cytochrome P450 11B1, mitochondrial antibody
    • Cytochrome p450 XIB1 antibody
    • Cytochrome P450, family 11, subfamily B, polypeptide 1 antibody
    • Cytochrome P450, subfamily XIB (steroid 11 beta hydroxylase), polypeptide 1 antibody
    • Cytochrome P450, subfamily XIB, polypeptide 1 antibody
    • Cytochrome P450C11 antibody
    • FHI antibody
    • P 450C11 antibody
    • P450C11 antibody
    • S11BH antibody
    • Steroid 11 beta hydroxylase antibody
    • Steroid 11 beta monooxygenase antibody
    see all

Images

  • All lanes : Anti-CYP11B1 antibody (ab229884) at 1/1000 dilution

    Lane 1 : Mouse heart tissue lysate
    Lane 2 : Mouse kidney tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 58, 50 kDa
    Observed band size: 58 kDa
    why is the actual band size different from the predicted?

References

ab229884 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229884.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up