Overview

  • Product name

  • Description

    Rabbit polyclonal to CYP21A2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse CYP21A2 aa 37-264. (Expressed in E.coli).
    Sequence:

    FLHFLQPNLPIYLLGLTQKLGPIYRIRLGMQDVVVLNSNRTIEEALIQKW VDFAGRPHMLNGKMDLDLSLGDYSLMWKAHKKLSRSALMLGMRDSMEPLI EQLTQEFCERMRAQAGTPVAIHKEFSFLTCSIISCLTFGDKDSTLVQTLH DCVQDLLQAWNHWSIQILTIIPLLRFLPNPGLQKLKQIQESRDHIVKQQL KQHKDSLVAGQWKDMIDYMLQGVEKQRD


    Database link: P03940

  • Positive control

    • IHC-P: Mouse testis and kidney tissues. WB: Recombinant mouse CYP21B protein; HEK-293T, Jurkat and HL-60 cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab232701 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 55 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Specifically catalyzes the 21-hydroxylation of steroids. Required for the adrenal synthesis of mineralocorticoids and glucocorticoids.
  • Involvement in disease

    Adrenal hyperplasia 3
  • Sequence similarities

    Belongs to the cytochrome P450 family.
  • Domain

    The leucine-rich hydrophobic amino acid N-terminal region probably helps to anchor the protein to the microsomal membrane.
  • Cellular localization

    Endoplasmic reticulum membrane. Microsome membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CYP21 antibody
    • 21 OHase antibody
    • 21-OHase antibody
    • CA21H antibody
    • CAH1 antibody
    • CP21A_HUMAN antibody
    • CPS1 antibody
    • CYP21A 2 antibody
    • CYP21A2 antibody
    • CYP21B antibody
    • Cytochrome P-450c21 antibody
    • Cytochrome P450 21 antibody
    • Cytochrome P450 C21B antibody
    • Cytochrome P450 XXI antibody
    • Cytochrome P450, family 21, subfamily A, polypeptide 2 antibody
    • Cytochrome P450, subfamily XXIA (steroid 21 hydroxylase, congenital adrenal hyperplasia), polypeptide 2 antibody
    • Cytochrome P450-C21 antibody
    • Cytochrome P450-C21B antibody
    • P450 C21 antibody
    • P450 C21B antibody
    • P450c21B antibody
    • Steroid 21 hydroxylase antibody
    • Steroid 21 monooxygenase antibody
    • Steroid 21-hydroxylase antibody
    see all

Images

  • All lanes : Anti-CYP21A2 antibody (ab232701) at 3 µg/ml

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : Jurkat (human T cell leukemia cell line from peripheral blood) cell lysate
    Lane 3 : HL-60 (human promyelocytic leukemia cell line) cell lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 55 kDa

  • Anti-CYP21A2 antibody (ab232701) at 3 µg/ml + Recombinant mouse CYP21B protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 55 kDa

  • Paraffin-embedded mouse kidney tissue stained for CYP21A2 using ab232701 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded mouse testis tissue stained for CYP21A2 using ab232701 at 20 µg/ml in immunohistochemical analysis. DAB staining.

References

ab232701 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232701.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up