Overview

  • Product name

  • Description

    Rabbit polyclonal to CYP21A2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human CYP21A2 aa 106-389. (Expressed in E.coli)
    Sequence:

    DLSLGDYSLLWKAHKKLTRSALLLGIRDSMEPVVEQLTQEFCERMRAQPG TPVAIEEEFSLLTCSIICYLTFGDKIKDDNLMPAYYKCIQEVLKTWSHWS IQIVDVIPFLRFFPNPGLRRLKQAIEKRDHIVEMQLRQHKESLVAGQWRD MMDYMLQGVAQPSMEEGSGQLLEGHVHMAAVDLLIGGTETTANTLSWAVV FLLHHPEIQQRLQEELDHELGPGASSSRVPYKDRARLPLLNATIAEVLRL RPVVPLALPHRTTRPSSISGYDIPEGTVIIPNLQ


    Database link: P08686

  • Positive control

    • WB: Recombinant human CYP21A2 and rat adrenal gland tissue. IHC-P: Human skin cancer, breast cancer, glioma, stomach cancer, bile duct cancer and pancreatic cancer tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab232809 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 56 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Specifically catalyzes the 21-hydroxylation of steroids. Required for the adrenal synthesis of mineralocorticoids and glucocorticoids.
  • Involvement in disease

    Adrenal hyperplasia 3
  • Sequence similarities

    Belongs to the cytochrome P450 family.
  • Domain

    The leucine-rich hydrophobic amino acid N-terminal region probably helps to anchor the protein to the microsomal membrane.
  • Cellular localization

    Endoplasmic reticulum membrane. Microsome membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CYP21 antibody
    • 21 OHase antibody
    • 21-OHase antibody
    • CA21H antibody
    • CAH1 antibody
    • CP21A_HUMAN antibody
    • CPS1 antibody
    • CYP21A 2 antibody
    • CYP21A2 antibody
    • CYP21B antibody
    • Cytochrome P-450c21 antibody
    • Cytochrome P450 21 antibody
    • Cytochrome P450 C21B antibody
    • Cytochrome P450 XXI antibody
    • Cytochrome P450, family 21, subfamily A, polypeptide 2 antibody
    • Cytochrome P450, subfamily XXIA (steroid 21 hydroxylase, congenital adrenal hyperplasia), polypeptide 2 antibody
    • Cytochrome P450-C21 antibody
    • Cytochrome P450-C21B antibody
    • P450 C21 antibody
    • P450 C21B antibody
    • P450c21B antibody
    • Steroid 21 hydroxylase antibody
    • Steroid 21 monooxygenase antibody
    • Steroid 21-hydroxylase antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human skin cancer tissue stained for CYP21A2 using ab232809 at 20μg/ml in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human breast cancer tissue stained for CYP21A2 using ab232809 at 20μg/ml in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human glioma tissue stained for CYP21A2 using ab232809 at 20μg/ml in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human stomach cancer tissue stained for CYP21A2 using ab232809 at 20μg/ml in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human bile duct cancer tissue stained for CYP21A2 using ab232809 at 20μg/ml in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human pancreatic cancer tissue stained for CYP21A2 using ab232809 at 20μg/ml in immunohistochemical analysis.

  • Anti-CYP21A2 antibody (ab232809) at 2 µg/ml + Recombinant human CYP21A2

    Developed using the ECL technique.

    Predicted band size: 56 kDa

  • Anti-CYP21A2 antibody (ab232809) at 2 µg/ml + Rat adrenal gland tissue

    Developed using the ECL technique.

    Predicted band size: 56 kDa

References

ab232809 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232809.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up