Overview

  • Product name

  • Description

    Rabbit polyclonal to CYP24A1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Synthetic peptide within Human CYP24A1 aa 360-410 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    LPENQVPRAEDLRNMPYLKACLKESMRLTPSVPFTTRTLDKATVLGEYAL P


    Database link: Q07973

  • Positive control

    • Human cervical carcinoma and mouse brain tissues; Mouse brain lysate.

Applications

Our Abpromise guarantee covers the use of ab203308 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 59 kDa.
IHC-P 1/100 - 1/500.

Target

  • Function

    Has a role in maintaining calcium homeostasis. Catalyzes the NADPH-dependent 24-hydroxylation of calcidiol (25-hydroxyvitamin D(3)) and calcitriol (1-alpha,25-dihydroxyvitamin D(3)). The enzyme can perform up to 6 rounds of hydroxylation of calcitriol leading to calcitroic acid. It also shows 23-hydroxylating activity leading to 1-alpha,25-dihydroxyvitamin D(3)-26,23-lactone as end product.
  • Sequence similarities

    Belongs to the cytochrome P450 family.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • 1 25 @dihydroxyvitamin D3 24 hydroxylase antibody
    • 1 25 dihydroxyvitamin D(3) 24 hydroxylase antibody
    • 1 antibody
    • 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial antibody
    • 24 OHase antibody
    • 24-OHase antibody
    • 25-dihydroxyvitamin D(3) 24-hydroxylase antibody
    • CP 24 antibody
    • CP24 antibody
    • CP24A_HUMAN antibody
    • CYP 24 antibody
    • CYP24 antibody
    • CYP24A1 antibody
    • Cytochrome P450 24A1 antibody
    • Cytochrome P450 24A1 mitochondrial antibody
    • cytochrome P450 CC24 antibody
    • Cytochrome P450 family 24 antibody
    • Cytochrome P450 family 24 subfamily A member 1 antibody
    • Cytochrome P450 family 24 subfamily A polypeptide 1 antibody
    • Cytochrome P450 subfamily XXIV antibody
    • Cytochrome P450, subfamily XXIV (vitamin D 24-hydroxylase) antibody
    • Cytochrome P450-CC24 antibody
    • EC 1.14.13.n4 antibody
    • Exo mitochondrial protein antibody
    • HCAI antibody
    • HCINF1 antibody
    • MGC126273 antibody
    • MGC126274 antibody
    • mitochondrial antibody
    • P450 CC24 antibody
    • Vitamin D 24 hydroxylase antibody
    • Vitamin D(3) 24 hydroxylase antibody
    • Vitamin D(3) 24-hydroxylase antibody
    see all

Images

  • Anti-CYP24A1 antibody (ab203308) at 1/200 dilution + mouse brain lysate

    Secondary
    Goat Anti-Rabbit IgG Antibody (H+L), HRP Conjugated at 1/3000 dilution

    Predicted band size: 59 kDa
    Observed band size: 55 kDa
    why is the actual band size different from the predicted?

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human cervical carcinoma tissue labeling CYP24A1 with ab203308 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded mouse brain tissue labeling CYP24A1 with ab203308 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab203308 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203308.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up