Overview

  • Product name

  • Description

    Rabbit polyclonal to CYP26A1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human CYP26A1 aa 73-255. N-terminal tags. Expressed in E. coli.
    Sequence:

    RKYGFIYKTHLFGRPTVRVMGADNVRRILLGEHRLVSVHWPASVRTILGS GCLSNLHDSSHKQRKKVIMRAFSREALECYVPVITEEVGSSLEQWLSCGE RGLLVYPEVKRLMFRIAMRILLGCEPQLAGDGDSEQQLVEAFEEMTRNLF SLPIDVPFSGLYRGMKARNLIHARIEQNIRAKI


    Database link: O43174

  • Positive control

    • WB: Recombinant human CYP26A1 protein; pig liver and heart tissue lysate; Jurkat whole cell lysate. IHC-P: Human breast cancer, lung and liver tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab232769 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 56 kDa.

Target

  • Function

    Plays a key role in retinoic acid metabolism. Acts on retinoids, including all-trans-retinoic acid (RA) and its stereoisomer 9-cis-RA. Capable of both 4-hydroxylation and 18-hydroxylation. Responsible for generation of several hydroxylated forms of RA, including 4-OH-RA, 4-oxo-RA and 18-OH-RA.
  • Tissue specificity

    Highest levels in adult liver, heart, pituitary gland, adrenal gland, placenta and regions of the brain.
  • Sequence similarities

    Belongs to the cytochrome P450 family.
  • Cellular localization

    Endoplasmic reticulum membrane. Microsome membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CP26 antibody
    • CP26A_HUMAN antibody
    • CYP26 antibody
    • CYP26A 1 antibody
    • cyp26a1 antibody
    • Cytochrome P450 26A1 antibody
    • Cytochrome P450 family 26 subfamily A polypeptide 1 antibody
    • Cytochrome P450 retinoic acid-inactivating 1 antibody
    • cytochrome P450, family 26, subfamily A, polypeptide 1 antibody
    • cytochrome P450, subfamily XXVIA, polypeptide 1 antibody
    • Cytochrome P450RAI antibody
    • hP450RAI antibody
    • OTTHUMP00000020102 antibody
    • OTTHUMP00000020103 antibody
    • P450 antibody
    • P450 retinoic acid inactivating 1 antibody
    • P450RAI antibody
    • P450RAI1 antibody
    • Retinoic acid 4 hydroxylase antibody
    • Retinoic acid 4-hydroxylase antibody
    • Retinoic acid metabolizing cytochrome antibody
    • Retinoic acid-metabolizing cytochrome antibody
    see all

Images

  • All lanes : Anti-CYP26A1 antibody (ab232769) at 3 µg/ml

    Lane 1 : Pig liver tissue lysate
    Lane 2 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 3 : Pig heart tissue lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 56 kDa

  • Formalin-fixed, paraffin-embedded human lung tissue stained for CYP26A1 using ab232769 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver tissue stained for CYP26A1 using ab232769 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human breast cancer tissue stained for CYP26A1 using ab232769 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-CYP26A1 antibody (ab232769) at 3 µg/ml + Recombinant human CYP26A1 protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 56 kDa

References

ab232769 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232769.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up