Overview

  • Product name

  • Description

    Rabbit polyclonal to CYP27C1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide corresponding to Human CYP27C1 aa 133-178.
    Sequence:

    HVDNKLRDIQYQMDRGRRVSGGLLTYLFLSQALTLQEIYANVTEML


    Database link: Q4G0S4

  • Positive control

    • HEK293T, NIH3T3 and PC12 whole cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab200679 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 43 kDa.

Target

  • Sequence similarities

    Belongs to the cytochrome P450 family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • C27C1_HUMAN antibody
    • CYP27C1 antibody
    • Cytochrome P450 27C1 antibody
    • Cytochrome P450 family 27 subfamily C polypeptide 1 antibody
    • Cytochrome P450 family 27 subfamily C polypeptide 13 antibody
    • FLJ16008 antibody
    see all

Images

  • All lanes : Anti-CYP27C1 antibody (ab200679)

    Lane 1 : HEK293T whole cell lysate
    Lane 2 : NIH3T3 whole cell lysate
    Lane 3 : PC12 whole cell lysate

    Predicted band size: 43 kDa

References

ab200679 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab200679.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up