Overview

  • Product name

  • Description

    Rabbit polyclonal to CYP27C1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CYP27C1 aa 242-317.
    Sequence:

    FPVLPGNGRVTQEDLVIGGYLIPKGTQLALCHYATSYQDENFPRAKEFRP ERWLRKGDLDRVDNFGSIPFGHGVRS


    Database link: Q4G0S4

  • Positive control

    • ICC/IF: HaCaT cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab221773 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Sequence similarities

    Belongs to the cytochrome P450 family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • C27C1_HUMAN antibody
    • CYP27C1 antibody
    • Cytochrome P450 27C1 antibody
    • Cytochrome P450 family 27 subfamily C polypeptide 1 antibody
    • Cytochrome P450 family 27 subfamily C polypeptide 13 antibody
    • FLJ16008 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized HaCaT (human keratinocyte cell line) cells stained for CYP27C1 (green) using ab221773 at 4 µg/ml in ICC/IF.

References

ab221773 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221773.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up