Overview

  • Product name
  • Description
    Rabbit polyclonal to CYP2A13
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Sheep, Horse, Guinea pig, Cow, Pig
  • Immunogen

    Synthetic peptide corresponding to Human CYP2A13 aa 401-450 (C terminal).
    Sequence:

    DPRFFSNPRDFNPQHFLDKKGQFKKSDAFVPFSIGKRYCFGEGLARMELF

  • Positive control
    • HepG2 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab58740 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 5 µg/ml. Detects a band of approximately 54 kDa (predicted molecular weight: 57 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

Titre using peptide based assay: 1:312500.

Target

  • Function
    Exhibits a coumarin 7-hydroxylase activity. Active in the metabolic activation of hexamethylphosphoramide, N,N-dimethylaniline, 2'-methoxyacetophenone, N-nitrosomethylphenylamine, and the tobacco-specific carcinogen, 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone. Possesses phenacetin O-deethylation activity.
  • Tissue specificity
    Expressed in liver and a number of extrahepatic tissues, including nasal mucosa, lung, trachea, brain, mammary gland, prostate, testis, and uterus, but not in heart, kidney, bone marrow, colon, small intestine, spleen, stomach, thymus, or skeletal muscle.
  • Sequence similarities
    Belongs to the cytochrome P450 family.
  • Cellular localization
    Endoplasmic reticulum membrane. Microsome membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • CP2AD_HUMAN antibody
    • CPAD antibody
    • CYP2A antibody
    • CYP2A13 antibody
    • CYPIIA13 antibody
    • Cytochrome P450 2A13 antibody
    • Cytochrome P450 family 2 subfamily A member 13 antibody
    • CYTOCHROME P450, SUBFAMILY IIA, POLYPEPTIDE 13 antibody
    see all

Images

  • Anti-CYP2A13 antibody (ab58740) at 5 µg/ml + HepG2 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/ 50,000 - 1/ 100,000 dilution.

    Predicted band size: 57 kDa
    Observed band size: 54 kDa
    why is the actual band size different from the predicted?

References

This product has been referenced in:
  • Kumondai M  et al. Functional characterization of 9 CYP2A13 allelic variants by assessment of nicotine C-oxidation and coumarin 7-hydroxylation. Drug Metab Pharmacokinet 33:82-89 (2018). Read more (PubMed: 29342418) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab58740.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up