Overview

  • Product name

  • Description

    Rabbit polyclonal to CYP2A6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Sheep, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to Human CYP2A6 aa 352-401 (C terminal).
    Sequence:

    MEAVIHEIQRFGDVIPMSLARRVKKDTKFRDFFLPKGTEVYPMLGSVLRD


    Database link: NP_000753

  • Positive control

    • Human fetal small intestine lysate
  • General notes

     This product was previously labelled as Cytochrome P450 2A6

     

Properties

Applications

Our Abpromise guarantee covers the use of ab133874 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 57 kDa.

Target

  • Function

    Exhibits a high coumarin 7-hydroxylase activity. Can act in the hydroxylation of the anti-cancer drugs cyclophosphamide and ifosphamide. Competent in the metabolic activation of aflatoxin B1. Constitutes the major nicotine C-oxidase. Possesses low phenacetin O-deethylation activity.
  • Tissue specificity

    Liver.
  • Sequence similarities

    Belongs to the cytochrome P450 family.
  • Cellular localization

    Endoplasmic reticulum membrane. Microsome membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Coumarin 7 hydroxylase antibody
    • Coumarin 7-hydroxylase antibody
    • CP2A6_HUMAN antibody
    • CPA6 antibody
    • CYP2A antibody
    • CYP2A3 antibody
    • CYP2A6 antibody
    • CYPIIA6 antibody
    • Cytochrome P450 2A6 antibody
    • Cytochrome P450 IIA3 antibody
    • Cytochrome P450 subfamily IIA (phenobarbital inducible) polypeptide 6 antibody
    • Cytochrome P450(I) antibody
    • Cytochrome P450, family 2 subfamily A polypeptide 6 antibody
    • Flavoprotein linked monooxygenase antibody
    • P450C2A antibody
    • P450PB antibody
    • Xenobiotic monooxygenase antibody
    see all

Images

  • Anti-CYP2A6 antibody (ab133874) at 1 µg/ml + Human fetal small intestine lysate at 10 µg

    Predicted band size: 57 kDa

References

ab133874 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab133874.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up