Overview

  • Product name

  • Description

    Rabbit polyclonal to CYP3A7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CYP3A7 aa 1-200.
    Sequence:

    MDLIPNLAVETWLLLAVSLILLYLYGTRTHGLFKKLGIPGPTPLPFLGNA LSFRKGYWTFDMECYKKYRKVWGIYDCQQPMLAITDPDMIKTVLVKECYS VFTNRRPFGPVGFMKNAISIAEDEEWKRIRSLLSPTFTSGKLKEMVPIIA QYGDVLVRNLRREAETGKPVTLKHVFGAYSMDVITSTSFGVSIDSLNNPQ


    Database link: P24462

  • Positive control

    • IHC-P: Human liver tissue. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab239020 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.

Target

  • Function

    Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics.
  • Sequence similarities

    Belongs to the cytochrome P450 family.
  • Cellular localization

    Endoplasmic reticulum membrane. Microsome membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Aryl hydrocarbon hydroxylase antibody
    • CP37 antibody
    • CP3A7_HUMAN antibody
    • CYP3A7 antibody
    • CYPIIIA7 antibody
    • Cytochrome P450 3A7 antibody
    • Cytochrome P450, family 3, subfamily A, polypeptide 7 antibody
    • Cytochrome P450, subfamily IIIA, polypeptide 7 antibody
    • Cytochrome P450-HFLA antibody
    • Flavoprotein linked monooxygenase antibody
    • Flavoprotein-linked monooxygenase antibody
    • Microsomal monooxygenase antibody
    • P 450(HFL33) antibody
    • P 450111A7 antibody
    • P450 HFLA antibody
    • Xenobiotic monooxygenase antibody
    see all

Images

  • Paraffin-embedded human liver tissue stained for CYP3A7 with ab239020 at 1/100 dilution in immunohistochemical analysis.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for CYP3A7 using ab239020 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

ab239020 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239020.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up