Overview

  • Product name

  • Description

    Rabbit polyclonal to CYP46A1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, ELISAmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Goat, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to Human CYP46A1 aa 396-445 (internal sequence).
    Sequence:

    YVMGRMDTYFEDPLTFNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQM


    Database link: NP_006659

  • Positive control

    • HepG2 Cell lysate This antibody gave a positive result when used in the following formaldehyde fixed cell lines: SKNSH.
  • General notes

     This product was previously labelled as CYP46

     

Properties

Applications

Our Abpromise guarantee covers the use of ab82814 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 µg/ml.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 57 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay 1:312500.

Target

  • Relevance

    The Cyp46 gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum protein is expressed exclusively in the brain, where it converts cholesterol to 24S-hydroxycholesterol by adding a hydroxyl group to cholesterol, producing a product that is more soluble than cholesterol and able to be exported from the brain. Cyp46 is also known as 24S-cholesterol hydroxylase
  • Cellular localization

    Endoplasmic reticulum
  • Database links

  • Alternative names

    • Cholesterol 24-hydroxylase antibody
    • CP46 antibody
    • CYP46 antibody
    • CYP46A1 antibody
    • cytochrome P450 family 46 antibody
    see all

Images

  • ICC/IF image of ab82814 stained SKNSH cells. The cells were 4% formaldehyde fixed (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody ab82814 at 1µg/ml overnight at +4°C. The secondary antibody (green) was DyLight® 488 goat anti- rabbit (ab96899) IgG (H+L) used at a 1/250 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.

  • Anti-CYP46A1 antibody (ab82814) at 1 µg/ml (in 5% skim milk / PBS buffer) + HepG2 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 57 kDa
    Observed band size: 50 kDa
    why is the actual band size different from the predicted?
    Additional bands at: 75 kDa. We are unsure as to the identity of these extra bands.

References

ab82814 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Application
Immunohistochemistry free floating
Sample
Mouse Tissue sections (BRAIN)
Specification
BRAIN

Abcam user community

Verified customer

Submitted Sep 21 2016

Application
Immunocytochemistry/ Immunofluorescence
Sample
Mouse Cell (Brain)
Permeabilization
Yes - TRITON-X 0.01%
Specification
Brain
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 3% · Temperature: RT°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Sep 21 2016

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up