Overview

  • Product name

  • Description

    Rabbit polyclonal to CYP4B1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CYP4B1 aa 64-186.
    Sequence:

    TGSLDKVVSWAHQFPYAHPLWFGQFIGFLNIYEPDYAKAVYSRGDPKAPD VYDFFLQWIGRGLLVLEGPKWLQHRKLLTPGFHYDVLKPYVAVFTESTRI MLDKWEEKAREGKSFDIFCDVGH


    Database link: P13584

  • Positive control

    • IHC-P: Human nasopharynx tissue. WB: CYP4B1 over-expression HEK-293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab224062 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 59 kDa.
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics.
  • Tissue specificity

    Detected in the liver and lung (at protein level).
  • Sequence similarities

    Belongs to the cytochrome P450 family.
  • Cellular localization

    Endoplasmic reticulum membrane. Microsome membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CP4B1_HUMAN antibody
    • CYP4B1 antibody
    • CYPIVB1 antibody
    • Cytochrome P450 4B1 antibody
    • Cytochrome P450 family 4 subfamily B polypeptide 1 antibody
    • Cytochrome P450 subfamily IVB polypeptide 1 antibody
    • Cytochrome P450-HP antibody
    • Microsomal monooxygenase antibody
    • P450HP antibody
    see all

Images

  • All lanes : Anti-CYP4B1 antibody (ab224062) at 1/100 dilution

    Lane 1 : Negative control (vector only transfected HEK-293T lysate)
    Lane 2 : CYP4B1 (with C-terminal myc-DDK tag, ~3.1 kDa) over-expression HEK-293T cell lysate

    Predicted band size: 59 kDa

  • Paraffin embedded human nasopharynx tissue stained for CYP4B1 with ab224062 (1/20 dilution) in immunohistochemical analysis.

References

ab224062 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224062.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up