Overview

  • Product name

  • Description

    Rabbit polyclonal to CYP4F2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CYP4F2 aa 56-105.
    Sequence:

    RRNWFWGHQGMVNPTEEGMRVLTQLVATYPQGFKVWMGPISPLLSLCHPD


    Database link: P78329

  • Positive control

    • IHC-P: Human liver tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab223725 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. The enzyme starts the process of inactivating and degrading leukotriene B4, a potent mediator of inflammation. This gene is part of a cluster of cytochrome P450 genes on chromosome 19.
  • Cellular localization

    Endoplasmic reticulum; endoplasmic reticulum membrane; peripheral membrane protein.
  • Database links

  • Alternative names

    • Cyp4f14 antibody
    • CYPIVF1 antibody
    • Cytochrome P450 LTB omega antibody
    • Cytochrome P450, family 4, subfamily F, polypeptide 2 antibody
    • EC 1.14.14.1 antibody
    • Leukotriene B(4) 20 monooxygenase antibody
    • Leukotriene B(4) omega hydroxylase antibody
    • MGC126966 antibody
    • MGC93476 antibody
    • P450 A3 antibody
    see all

Images

  • Paraffin embedded human liver tissue stained for CYP4F2 with ab223725 (1/20 dilution) in immunohistochemical analysis.

References

ab223725 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223725.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up