Overview

  • Product name

  • Description

    Rabbit polyclonal to CYP4V2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human CYP4V2 aa 246-525.
    Sequence:

    LMFKEGWEHKKSLQILHTFTNSVIAERANEMNANEDCRGDGRGSAPSKNK RRAFLDLLLSVTDDEGNRLSHEDIREEVDTFMFEGHDTTAAAINWSLYLL GSNPEVQKKVDHELDDVFGKSDRPATVEDLKKLRYLECVIKETLRLFPSV PLFARSVSEDCEVAGYRVLKGTEAVIIPYALHRDPRYFPNPEEFQPERFF PENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTILSCILRHFWIESNQK REELGLEGQLILRPSNGIWIKLKRRNADER


    Database link: Q6ZWL3-1

  • Positive control

    • WB: Jurkat whole cell lysate (ab7899). IHC-P: Human kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224742 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000.
IHC-P 1/20 - 1/200.

Target

  • Function

    Catalyzes the omega-hydroxylation of medium-chain saturated fatty acids such as laurate, myristate and palmitate in an NADPH-dependent pathway. The substrate specificity is higher for myristate > laurate > palmitate (C14>C16>C12). May have a role in fatty acid and steroid metabolism in the eye.
  • Tissue specificity

    Broadly expressed. Detected in heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, retina, retinal pigment epithelium (RPE) and lymphocytes.
  • Involvement in disease

    Bietti crystalline corneoretinal dystrophy (BCD) [MIM:210370]: An autosomal recessive ocular disease characterized by retinal degeneration and marginal corneal dystrophy. Typical features include multiple glistening intraretinal crystals scattered over the fundus, a characteristic degeneration of the retina, and sclerosis of the choroidal vessels, ultimately resulting in progressive night blindness and constriction of the visual field. Most patients have similar crystals at the corneoscleral limbus. Patients develop decreased vision, nyctalopia, and paracentral scotomata between the 2nd and 4th decade of life. Later, they develop peripheral visual field loss and marked visual impairment, usually progressing to legal blindness by the 5th or 6th decade of life. Note=The disease is caused by mutations affecting the gene represented in this entry.
  • Sequence similarities

    Belongs to the cytochrome P450 family.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • BCD antibody
    • CP4V2_HUMAN antibody
    • CYP4AH1 antibody
    • CYP4V 2 antibody
    • CYP4V2 antibody
    • Cytochrome P450 4V2 antibody
    • Cytochrome P450, family 4, subfamily V, polypeptide 2 antibody
    • Retina CYP4V2 antibody
    see all

Images

  • Paraffin embedded human kidney tissue stained for CYP4V2 with ab224742 (1/100 dilution) in immunohistochemical analysis.

  • Anti-CYP4V2 antibody (ab224742) at 1/1000 dilution + Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate

    Secondary
    Goat polyclonal to rabbit at 1/10000 dilution

    Developed using the ECL technique.

References

ab224742 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224742.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up