Overview

  • Product name

  • Description

    Rabbit polyclonal to CYP7A1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CYP7A1 aa 303-423.
    Sequence:

    RNPEAMKAATEEVKRTLENAGQKVSLEGNPICLSQAELNDLPVLDSIIKE SLRLSSASLNIRTAKEDFTLHLEDGSYNIRKDDIIALYPQLMHLDPEIYP DPLTFKYDRYLDENGKTKTTF


    Database link: P22680

  • Positive control

    • WB: HeLa and K562 whole cell lysates. IHC-P: Human liver tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab234982 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500.
WB 1/500 - 1/5000. Predicted molecular weight: 57 kDa.

Target

  • Function

    Catalyzes a rate-limiting step in cholesterol catabolism and bile acid biosynthesis by introducing a hydrophilic moiety at position 7 of cholesterol. Important for cholesterol homeostasis.
  • Tissue specificity

    Detected in liver.
  • Pathway

    Lipid metabolism; bile acid biosynthesis.
  • Sequence similarities

    Belongs to the cytochrome P450 family.
  • Cellular localization

    Endoplasmic reticulum membrane. Microsome membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cholesterol 7 alpha hydroxylase antibody
    • Cholesterol 7 alpha monooxygenase antibody
    • Cholesterol 7-alpha-hydroxylase antibody
    • Cholesterol 7-alpha-monooxygenase antibody
    • CP7A antibody
    • CP7A1_HUMAN antibody
    • CYP 7 antibody
    • CYP7 antibody
    • CYP7A1 antibody
    • CYPVII antibody
    • Cytochrome P450 7A1 antibody
    • Cytochrome P450, family 7, subfamily A, polypeptide 1 antibody
    • Cytochrome P450, subfamily VIIA (cholesterol 7 alpha monooxygenase), antibody
    • Cytochrome P450, subfamily VIIA (cholesterol 7 alpha-monooxygenase), polypeptide 1 antibody
    • MGC126826 antibody
    • MGC138389 antibody
    see all

Images

  • All lanes : Anti-CYP7A1 antibody (ab234982) at 1/500 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : K562 (human chronic myelogenous leukemia cell line from bone marrow) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 57 kDa

  • Paraffin-embedded human liver tissue stained for CYP7A1 with ab234982 at 1/300 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

References

ab234982 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234982.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up