Overview

  • Product name

  • Description

    Rabbit polyclonal to CYP8B1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CYP8B1 aa 303-440.
    Sequence:

    EAIRAVREEATQVLGEARLETKQSFAFKLGALQHTPVLDSVVEETLRLRA APTLLRLVHEDYTLKMSSGQEYLFRHGDILALFPYLSVHMDPDIHPEPTV FKYDRFLNPNGSRKVDFFKTGKKIHHYTMPWGSGVSIC


    Database link: Q9UNU6

  • Positive control

    • IHC-P: Human liver and liver cancer tissue. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab236607 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Involved in bile acid synthesis and is responsible for the conversion of 7 alpha-hydroxy-4-cholesten-3-one into 7 alpha, 12 alpha-dihydroxy-4-cholesten-3-one. Responsible for the balance between formation of cholic acid and chenodeoxycholic acid. Has a rather broad substrate specificity including a number of 7-alpha-hydroxylated C27 steroids.
  • Tissue specificity

    Liver.
  • Sequence similarities

    Belongs to the cytochrome P450 family.
  • Cellular localization

    Endoplasmic reticulum membrane. Microsome membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 7-alpha-hydroxy-4-cholesten-3-one 12-alpha-hydroxylase antibody
    • 7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase antibody
    • CP8B antibody
    • CP8B1_HUMAN antibody
    • CYP12 antibody
    • CYP8B1 antibody
    • CYPVIIIB1 antibody
    • Cytochrome P450 8B1 antibody
    • Cytochrome P450 subfamily VIIIB (sterol 12 alpha hydroxylase) polypeptide 1 antibody
    • Cytochrome P450, family 8, subfamily B, polypeptide 1 antibody
    • Sterol 12-alpha-hydroxylase antibody
    see all

Images

  • 4% formaldehyde-fixed, 0.2% Triton X-100 permeabilized HepG2 (human liver hepatocellular carcinoma cell line) cells labeling CYP8B1 (green) using ab236607 at 1/100 dilution in ICC/IF. Counter stained with DAPI (blue). The cells were blocked in 10% normal goat serum and incubated with primary antibody at 4°C overnight. The secondary antibody was Alexa Fluor 488-conjugated goat anti-rabbit IgG (H+L).

  • Paraffin-embedded human liver tissue stained for CYP8B1 using ab236607 at 1/300 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • Paraffin-embedded human liver cancer tissue stained for CYP8B1 using ab236607 at 1/300 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

References

ab236607 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236607.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up