Overview

  • Product name

  • Description

    Rabbit polyclonal to CysLT1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Horse, Guinea pig, Cow, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within C terminal amino acids 199-248 (IIPFVIIIVCYTMIILTLLKKSMKKNLSSHKKAIGMIMVVTAAFLVSFM P) of Human CysLT1 (NP_006630).

  • Positive control

    • Human fetal heart lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab122959 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 39 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function

    Receptor for cysteinyl leukotrienes mediating bronchoconstriction of individuals with and without asthma. Stimulation by LTD4 results in the contraction and proliferation of smooth muscle, edema, eosinophil migration and damage to the mucus layer in the lung. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. The rank order of affinities for the leukotrienes is LTD4 >> LTE4 = LTC4 >> LTB4.
  • Tissue specificity

    Widely expressed, with highest levels in spleen and peripheral blood leukocytes. Lower expression in several tissues, such as lung (mostly in smooth muscle bundles and alveolar macrophages), placenta, small intestine, pancreas, colon and heart.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CLTR1_HUMAN antibody
    • CYSLT 1 antibody
    • CysLT(1) antibody
    • CYSLT1R antibody
    • CYSLTR 1 antibody
    • CYSLTR antibody
    • CysLTR vide supra antibody
    • CysLTR1 antibody
    • Cysteinyl leukotriene D4 receptor antibody
    • Cysteinyl leukotriene receptor 1 antibody
    • G-protein coupled receptor HG55 antibody
    • HG55 antibody
    • HMTMF81 antibody
    • LTD4 receptor antibody
    • MGC46139 antibody
    see all

Images

  • Anti-CysLT1 antibody (ab122959) at 1 µg/ml + Human fetal heart lysate at 10 µg

    Predicted band size: 39 kDa



    Gel concentration: 12%

References

ab122959 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab122959.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up