Overview

  • Product name

    Anti-Cystathionase/CTH antibody
    See all Cystathionase/CTH primary antibodies
  • Description

    Rabbit polyclonal to Cystathionase/CTH
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Cow, Cynomolgus monkey
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human Cystathionase/CTH aa 163-382. Expressed in E.coli.
    Sequence:

    TQKVIDIEGCAHIVHKHGDIILVVDNTFMSPYFQRPLALGADISMYSATK YMNGHSDVVMGLVSVNCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTL HVRMEKHFKNGMAVAQFLESNPWVEKVIYPGLPSHPQHELVKRQCTGCTG MVTFYIKGTLQHAEIFLKNLKLFTLAESLGGFESLAELPAIMTHASVLKN DRDVLGISDTLIRLSVGLED


    Database link: P32929

  • Positive control

    • WB: Recombinant human Cystathionase/CTH protein; Pig liver lysate. IHC-P: Human kidney, liver and stomach tissue.
  • General notes

     This product was previously labelled as Cystathionase

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232974 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 45 kDa.

Target

  • Function

    Catalyzes the last step in the transsulfuration pathway from methionine to cysteine. Has broad substrate specificity. Converts cystathionine to cysteine, ammonia and 2-oxobutanoate. Converts two cysteine molecules to lanthionine and hydrogen sulfide. Can also accept homocysteine as substrate. Specificity depends on the levels of the endogenous substrates. Generates the endogenous signaling molecule hydrogen sulfide (H2S), and so contributes to the regulation of blood pressure.
  • Pathway

    Amino-acid biosynthesis; L-cysteine biosynthesis; L-cysteine from L-homocysteine and L-serine: step 2/2.
  • Involvement in disease

    Defects in CTH are the cause of cystathioninuria (CSTNU) [MIM:219500]. It is an autosomal recessive phenotype characterized by abnormal accumulation of plasma cystathionine, leading to increased urinary excretion.
  • Sequence similarities

    Belongs to the trans-sulfuration enzymes family.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • CGL_HUMAN antibody
    • CTH antibody
    • cystathionase (cystathionine gamma-lyase) antibody
    • Cystathionine gamma lyase antibody
    • Cystathionine gamma-lyase antibody
    • Cysteine desulfhydrase antibody
    • Gamma cystathionase antibody
    • Gamma-cystathionase antibody
    • Homoserine deaminase antibody
    • Homoserine dehydratase antibody
    • MGC9471 antibody
    see all

Images

  • Anti-Cystathionase/CTH antibody (ab232974) at 2 µg/ml + Recombinant human Cystathionase/CTH protein

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 45 kDa

  • Anti-Cystathionase/CTH antibody (ab232974) at 2 µg/ml + Pig liver lysate

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 45 kDa

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for Cystathionase/CTH using ab232974 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver tissue stained for Cystathionase/CTH using ab232974 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for Cystathionase/CTH using ab232974 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab232974 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232974.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up