Overview

  • Product name

  • Description

    Rabbit polyclonal to Cystatin-B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IP, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee, Gorilla
  • Immunogen

    Recombinant full length protein corresponding to Human Cystatin-B aa 1-98.
    Sequence:

    MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAG TNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF


    Database link: P04080

  • Positive control

    • WB: EC109, HEK-293T, HepG2, MCF7, A549, U-87 MG and HEK-293T whole cell lysates. IHC-P: Human colon cancer and lung cancer tissues. ICC/IF: HepG2 cells. IP: HepG2 whole cell lysate.
  • General notes

     This product was previously labelled as Stefin B

     

Properties

Applications

Our Abpromise guarantee covers the use of ab236646 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IP 1/200 - 1/2000.
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 11 kDa.

Target

  • Function

    This is an intracellular thiol proteinase inhibitor. Tightly binding reversible inhibitor of cathepsins L, H and B.
  • Involvement in disease

    Defects in CSTB are the cause of progressive myoclonic epilepsy type 1 (EPM1) [MIM:254800]. EPM1 is an autosomal recessive disorder characterized by severe, stimulus-sensitive myoclonus and tonic-clonic seizures. The onset, occurring between 6 and 13 years of age, is characterized by convulsions. Myoclonus begins 1 to 5 years later. The twitchings occur predominantly in the proximal muscles of the extremities and are bilaterally symmetrical, although asynchronous. At first small, they become late in the clinical course so violent that the victim is thrown to the floor. Mental deterioration and eventually dementia develop.
  • Sequence similarities

    Belongs to the cystatin family.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • CHROW21 antibody
    • CPI B antibody
    • CPI-B antibody
    • CST 6 antibody
    • CST6 antibody
    • CSTB antibody
    • Cystatin B (stefin B) antibody
    • Cystatin B antibody
    • Cystatin-B antibody
    • CYTB antibody
    • CYTB_HUMAN antibody
    • EPM1 antibody
    • EPM1A antibody
    • Liver thiol proteinase inhibitor antibody
    • PME antibody
    • Stefin-B antibody
    • STF B antibody
    • STFB antibody
    • ULD antibody
    see all

Images

  • All lanes : Anti-Cystatin-B antibody (ab236646) at 1/1000 dilution

    Lane 1 : EC109 whole cell lysate
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/50000 dilution

    Predicted band size: 11 kDa

  • Paraffin-embedded human colon cancer tissue stained for Cystatin-B using ab236646 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human lung cancer tissue stained for Cystatin-B using ab236646 at 1/100 dilution in immunohistochemical analysis.

  • All lanes : Anti-Cystatin-B antibody (ab236646) at 1/1000 dilution

    Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 2 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate
    Lane 3 : A549 (human lung carcinoma cell line) whole cell lysate
    Lane 4 : U-87 MG (human glioblastoma-astrocytoma epithelial cell line) whole cell lysate
    Lane 5 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 11 kDa

  • 4% formaldehyde-fixed, 0.2% Triton X-100 permeabilized HepG2 (human liver hepatocellular carcinoma cell line) cells stained for Cystatin-B (green) using ab236646 at 1/133 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L). Counter-stained with DAPI.

  • Cystatin-B was immunoprecipitated from 500 µg HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate with ab236646 at 1/200 dilution. 

    Lane 1: Rabbit control IgG IP in HepG2 whole cell lysate.

    Lane 2: ab236646 IP in HepG2 whole cell lysate.

    Lane 3: HepG2 whole cell lysate 20 µg (Input).

    For western blotting, an HRP-conjugated Protein G antibody was used as the secondary antibody at 1/2000 dilution.

References

ab236646 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236646.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up