Overview

  • Product name

  • Description

    Rabbit polyclonal to Cystatin C
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Cow
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Cow Cystatin C aa 32-148. Expressed in E.coli. N-terminal tag.
    Sequence:

    GPRKGRLLGGLMEADVNEEGVQEALSFAVSEFNKRSNDAYQSRVVRVVRA RKQVVSGMNYFLDVELGRTTCTKSQANLDSCPFHNQPHLKREKLCSFQVY VVPWMNTINLVKFSCQD


    Database link: P01035

  • Positive control

    • WB: Recombinant cow Cystatin C protein; cow brain and cerebrum lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab231599 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 16 kDa.

Target

  • Function

    As an inhibitor of cysteine proteinases, this protein is thought to serve an important physiological role as a local regulator of this enzyme activity.
  • Tissue specificity

    Expressed in submandibular and sublingual saliva but not in parotid saliva (at protein level). Expressed in various body fluids, such as the cerebrospinal fluid and plasma. Expressed in highest levels in the epididymis, vas deferens, brain, thymus, and ovary and the lowest in the submandibular gland.
  • Involvement in disease

    Amyloidosis 6
    Macular degeneration, age-related, 11
  • Sequence similarities

    Belongs to the cystatin family.
  • Post-translational
    modifications

    The Thr-25 variant is O-glycosylated with a core 1 or possibly core 8 glycan. The signal peptide of the O-glycosylated Thr-25 variant is cleaved between Ala-20 and Val-21.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • AD 8 antibody
    • AD8 antibody
    • Amyloid angiopathy and cerebral hemorrhage antibody
    • ARMD11 antibody
    • bA218C14.4 (cystatin C) antibody
    • bA218C14.4 antibody
    • Cst 3 antibody
    • Cst3 antibody
    • CST3 protein antibody
    • Cystatin 3 antibody
    • Cystatin-3 antibody
    • Cystatin-C antibody
    • Cystatin3 antibody
    • CystatinC antibody
    • CYTC_HUMAN antibody
    • Epididymis secretory protein Li 2 antibody
    • Gamma trace antibody
    • Gamma-trace antibody
    • HCCAA antibody
    • HEL S 2 antibody
    • MGC117328 antibody
    • Neuroendocrine basic polypeptide antibody
    • Post gamma globulin antibody
    • Post-gamma-globulin antibody
    see all

Images

  • Anti-Cystatin C antibody (ab231599) at 2 µg/ml + Cow cerebrum lysate

    Predicted band size: 16 kDa

  • Anti-Cystatin C antibody (ab231599) at 2 µg/ml + Cow brain lysate

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/1000 dilution

    Predicted band size: 16 kDa

  • Anti-Cystatin C antibody (ab231599) at 2 µg/ml + Recombinant cow Cystatin 3 protein

    Predicted band size: 16 kDa

References

ab231599 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231599.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up