Overview

  • Product name

    Anti-Cystatin SA/CST2 antibody
    See all Cystatin SA/CST2 primary antibodies
  • Description

    Rabbit polyclonal to Cystatin SA/CST2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human Cystatin SA/CST2 aa 21-141. Without signal peptide (BC062679).
    Sequence:

    WSPQEEDRIIEGGIYDADLNDERVQRALHFVISEYNKATEDEYYRRLLRV LRAREQIVGGVNYFFDIEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSF QIYEVPWEDRMSLVNSRCQEA


    Database link: P09228

  • Positive control

    • Human fetal skin

Properties

  • Form

    Lyophilised:Reconstitute in 200ul sterile water
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 98% PBS, 1% BSA
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab206845 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
WB 1/200 - 1/1000. Predicted molecular weight: 16 kDa.

Target

  • Function

    Thiol protease inhibitor.
  • Tissue specificity

    Expressed in submandibular and sublingual saliva but not in parotid saliva (at protein level). Expressed in submandibular gland and parotid gland.
  • Sequence similarities

    Belongs to the cystatin family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • CST 2 antibody
    • CST2 antibody
    • Cystatin 2 antibody
    • Cystatin S5 antibody
    • Cystatin-2 antibody
    • Cystatin-S5 antibody
    • Cystatin-SA antibody
    • Cysteine proteinase inhibitor antibody
    • CYTT_HUMAN antibody
    • MGC71924 antibody
    • Salivary cysteine (thiol) protease inhibitor antibody
    see all

Images

  • Anti-Cystatin SA/CST2 antibody (ab206845) at 1/500 dilution + Recombinant Cystatin SA/CST2 protein

    Predicted band size: 16 kDa

  • Immunohistochemical analysis of Human fetal skin labeling Cystatin SA/CST2 with ab206845 at 1/100 dilution.

References

ab206845 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab206845.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up