Overview

  • Product name

    Anti-Cysteine Dioxygenase CDO1 antibody
    See all Cysteine Dioxygenase CDO1 primary antibodies
  • Description

    Rabbit polyclonal to Cysteine Dioxygenase CDO1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human Cysteine Dioxygenase CDO1 aa 1-200.
    Sequence:

    MEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMY AKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTNSHCFLKMLQG NLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSIGLHRVENISHTEP AVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENN


    Database link: Q16878

  • Positive control

    • IHC-P: Human liver cancer and pancreatic cancer tissue.
  • General notes

    Previously labelled as Cysteine Dioxygenase Type 1.

Properties

Applications

Our Abpromise guarantee covers the use of ab234693 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Initiates several important metabolic pathways related to pyruvate and several sulfurate compounds including sulfate, hypotaurine and taurine. Critical regulator of cellular cysteine concentrations. Has an important role in maintaining the hepatic concentation of intracellular free cysteine within a proper narrow range.
  • Tissue specificity

    Highly expressed in liver and placenta. Low expression in heart, brain and pancreas. Also detected in hepatoblastoma HepG2 cells.
  • Pathway

    Organosulfur biosynthesis; taurine biosynthesis; hypotaurine from L-cysteine: step 1/2.
  • Sequence similarities

    Belongs to the cysteine dioxygenase family.
  • Post-translational
    modifications

    The thioether cross-link between Cys-93 and Tyr-157 plays a structural role through stabilizing the Fe(2+) ion, and prevents the production of highly damaging free hydroxyl radicals by holding the oxygen radical via hydroxyl hydrogen.
  • Information by UniProt
  • Database links

  • Alternative names

    • CDO 1 antibody
    • CDO antibody
    • CDO I antibody
    • CDO-I antibody
    • Cdo1 antibody
    • CDO1_HUMAN antibody
    • CDOI antibody
    • Cysteine dioxygenase type 1 antibody
    • Cysteine dioxygenase type I antibody
    • Cytosolic cysteine dioxygenase antibody
    see all

Images

  • Paraffin-embedded human liver cancer tissue stained for Cysteine Dioxygenase CDO1 using ab234693 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human pancreatic cancer tissue stained for Cysteine Dioxygenase CDO1 using ab234693 at 1/100 dilution in immunohistochemical analysis.

References

ab234693 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234693.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up