Overview

  • Product name

  • Description

    Rabbit polyclonal to Cyt 19
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat, Human
  • Immunogen

    Synthetic peptide within Human Cyt 19 aa 65-95 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    IPEHLENCWILDLGSGSGRDCYVLSQLVGEK


    Database link: Q9HBK9

  • Positive control

    • Mouse heart and liver lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab216971 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 42 kDa.

Target

  • Function

    Catalyzes the transfer of a methyl group from AdoMet to trivalent arsenicals producing methylated and dimethylated arsenicals. It methylates arsenite to form methylarsonate, Me-AsO(3)H(2), which is reduced by methylarsonate reductase to methylarsonite, Me-As(OH)2. Methylarsonite is also a substrate and it is converted into the much less toxic compound dimethylarsinate (cacodylate), Me(2)As(O)-OH.
  • Sequence similarities

    Belongs to the methyltransferase superfamily.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2310045H08Rik antibody
    • Arsenic (+3 oxidation state) methyltransferase antibody
    • Arsenite methyltransferase antibody
    • As3mt antibody
    • AS3MT_HUMAN antibody
    • C10ORF32 antibody
    • CYT19 antibody
    • Cyt19 protein antibody
    • Hypothetical protein C10orf32 antibody
    • Methylarsonite methyltransferase antibody
    • Methyltransferase cyt19 antibody
    • OTTHUMP00000020384 antibody
    • RP11-753C18.6 antibody
    • S adenosylmethionine arsenic (III) methyltransferase antibody
    • S-adenosyl-L-methionine:arsenic(III) methyltransferase antibody
    see all

Images

  • All lanes : Anti-Cyt 19 antibody (ab216971) at 1/300 dilution

    Lane 1 : mouse heart lysate
    Lane 2 : mouse liver lysate

    Secondary
    All lanes : Goat Anti-Rabbit IgG Antibody (H+L), HRP at 1/5000 dilution

    Developed using the ECL technique.

    Predicted band size: 42 kDa

References

ab216971 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216971.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up