Overview

  • Product name

    Anti-Cytochrome b-c1 complex subunit 9/UQCR10 antibody
    See all Cytochrome b-c1 complex subunit 9/UQCR10 primary antibodies
  • Description

    Rabbit polyclonal to Cytochrome b-c1 complex subunit 9/UQCR10
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Cytochrome b-c1 complex subunit 9/UQCR10 aa 1-63.
    Sequence:

    MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEG KLWKHIKHKYENK


    Database link: Q9UDW1

  • Positive control

    • WB: HepG2 whole cell lysate. IHC-P: Human heart and skeletal muscle tissue.
  • General notes

     This product was previously labelled as Cytochrome b-c1 complex subunit 9

     

Properties

Applications

Our Abpromise guarantee covers the use of ab235367 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 7 kDa.
IHC-P 1/20 - 1/200.

Target

  • Relevance

    Function: This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit interacts with cytochrome c1. Similarity: Belongs to the UQCR10/QCR9 family.
  • Cellular localization

    Mitochondrial; Mitochondrion inner membrane
  • Database links

  • Alternative names

    • Cytochrome c1 non heme 7 kDa protein antibody
    • Cytochrome C1 nonheme 7kDa protein antibody
    • HSPC051 antibody
    • HSPC119 antibody
    • HSPC151 antibody
    • QCR9 antibody
    • Ubiquinol cytochrome c reductase complex antibody
    • Ubiquinol cytochrome c reductase complex (7.2 kD) antibody
    • Ubiquinol cytochrome c reductase complex 7.2 kDa protein antibody
    • Ubiquinol cytochrome c reductase complex III subunit X 7.2kDa antibody
    • Ubiquinol cytochrome c reductase complex III subunit X antibody
    • UCCR7.2 antibody
    • UCRC antibody
    • UQCR10 antibody
    see all

Images

  • Anti-Cytochrome b-c1 complex subunit 9/UQCR10 antibody (ab235367) at 1/1000 dilution + HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 7 kDa

  • Paraffin-embedded human heart tissue stained for Cytochrome b-c1 complex subunit 9/UQCR10 using ab235367 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human skeletal muscle tissue stained for Cytochrome b-c1 complex subunit 9/UQCR10 using ab235367 at 1/100 dilution in immunohistochemical analysis.

References

ab235367 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235367.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up