Overview

  • Product name

    Anti-Cytochrome P450 17A1/CYP17A1 antibody
    See all Cytochrome P450 17A1/CYP17A1 primary antibodies
  • Description

    Rabbit polyclonal to Cytochrome P450 17A1/CYP17A1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat Cytochrome P450 17A1/CYP17A1 aa 201-507. (Expressed in E.coli)
    Sequence:

    TEGIVDATGDRNLVDIFPWLTIFPNKGLEVIKGYAKVRNEVLTGIFEKCR EKFDSQSISSLTDILIQAKMNSDNNNSCEGRDPDVFSDRHILATVGDIFG AGIETTTTVLKWILAFLVHNPEVKKKIQKEIDQYVGFSRTPTFNDRSHLL MLEATIREVLRIRPVAPMLIPHKANVDSSIGEFTVPKDTHVVVNLWALHH DENEWDQPDQFMPERFLDPTGSHLITPTQSYLPFGAGPRSCIGEALARQE LFVFTALLLQRFDLDVSDDKQLPRLEGDPKVVFLIDPFKVKITVRQAWMD AQAEVST


    Database link: P11715

  • Positive control

    • IHC-P: Rat testis and adrenal gland tissue. WB: Recombinant rat Cytochrome P450 17A1/CYP17A1 protein; Rat testis and A549 cell lysate.
  • General notes

     This product was previously labelled as Cytochrome P450 17A1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab231794 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Conversion of pregnenolone and progesterone to their 17-alpha-hydroxylated products and subsequently to dehydroepiandrosterone (DHEA) and androstenedione. Catalyzes both the 17-alpha-hydroxylation and the 17,20-lyase reaction. Involved in sexual development during fetal life and at puberty.
  • Pathway

    Lipid metabolism; steroid biosynthesis.
  • Involvement in disease

    Defects in CYP17A1 are the cause of adrenal hyperplasia type 5 (AH5) [MIM:202110]. AH5 is a form of congenital adrenal hyperplasia, a common recessive disease due to defective synthesis of cortisol. Congenital adrenal hyperplasia is characterized by androgen excess leading to ambiguous genitalia in affected females, rapid somatic growth during childhood in both sexes with premature closure of the epiphyses and short adult stature. Four clinical types: "salt wasting" (SW, the most severe type), "simple virilizing" (SV, less severely affected patients), with normal aldosterone biosynthesis, "non-classic form" or late onset (NC or LOAH), and "cryptic" (asymptomatic).
  • Sequence similarities

    Belongs to the cytochrome P450 family.
  • Post-translational
    modifications

    Phosphorylation is necessary for 17,20-lyase, but not for 17-alpha-hydroxylase activity.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 20 lyase antibody
    • CP17A_HUMAN antibody
    • CPT7 antibody
    • CYP17 antibody
    • CYP17A1 antibody
    • CYPXVII antibody
    • Cytochrome P450 17A1 antibody
    • Cytochrome P450 family 17 antibody
    • Cytochrome P450 family 17 subfamily A polypeptide 1 antibody
    • Cytochrome p450 subfamily XVII (steroid 17 alpha hydroxylase) adrenal hyperplasia antibody
    • Cytochrome p450 XVIIA1 antibody
    • Cytochrome P450-C17 antibody
    • Cytochrome P450c17 antibody
    • OTTHUMP00000020382 antibody
    • P450 C17 antibody
    • P450c17 antibody
    • S17AH antibody
    • Steroid 17 alpha hydroxylase/17,20 lyase antibody
    • Steroid 17 alpha monooxygenase antibody
    • Steroid 17-alpha-hydroxylase/17 antibody
    • Steroid 17-alpha-monooxygenase antibody
    see all

Images

  • All lanes : Anti-Cytochrome P450 17A1/CYP17A1 antibody (ab231794) at 1 µg/ml

    Lane 1 : Rat testis tissue lysate
    Lane 2 : A549 (human lung carcinoma cell line) cell lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit Ab at 1/2000 dilution

    Developed using the ECL technique.
  • Anti-Cytochrome P450 17A1/CYP17A1 antibody (ab231794) at 1 µg/ml + Recombinant rat Cytochrome P450 17A1/CYP17A1 protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit Ab at 1/2000 dilution

    Developed using the ECL technique.
  • Formalin-fixed, paraffin-embedded rat adrenal gland tissue stained for Cytochrome P450 17A1/CYP17A1 using ab231794 at 20µg/mL in immunohistochemical analysis. DAB-staining.

  • Formalin-fixed, paraffin-embedded rat testis tissue stained for Cytochrome P450 17A1/CYP17A1 using ab231794 at 20µg/mL in immunohistochemical analysis. DAB-staining.

References

ab231794 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231794.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up