Anti-Cytochrome P450 17A1/CYP17A1 antibody (ab231914)
Key features and details
- Rabbit polyclonal to Cytochrome P450 17A1/CYP17A1
- Suitable for: WB, IHC-P
- Reacts with: Mouse, Rat
- Isotype: IgG
Overview
-
Product name
Anti-Cytochrome P450 17A1/CYP17A1 antibody
See all Cytochrome P450 17A1/CYP17A1 primary antibodies -
Description
Rabbit polyclonal to Cytochrome P450 17A1/CYP17A1 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat -
Immunogen
Recombinant fragment (His-T7-tag) corresponding to Mouse Cytochrome P450 17A1/CYP17A1 aa 201-507. (Expressed in E.coli).
Sequence:TEGIVDVLGHSDLVDIFPWLKIFPNKNLEMIKEHTKIREKTLVEMFEKCK EKFNSESLSSLTDILIQAKMNAENNNTGEGQDPSVFSDKHILVTVGDIFG AGIETTSSVLNWILAFLVHNPEVKRKIQKEIDQYVGFSRTPSFNDRTHLL MLEATIREVLRIRPVAPLLIPHKANIDSSIGEFAIPKDTHVIINLWALHH DKNEWDQPDRFMPERFLDPTGSHLITPTPSYLPFGAGPRSCIGEALARQE LFIFMALLLQRFDFDVSDDKQLPCLVGDPKVVFLIDPFKVKITVRQAWKD AQVEVST
Database link: P27786 -
Positive control
- IHC-P: Mouse testis and kidney tissues. WB: Rat testis lysate; Recombinant mouse Cytochrome P450 17A1/CYP17A1 protein.
-
General notes
This product was previously labelled as Cytochrome P450 17A1
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab231914 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab231914 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 58 kDa. | |
IHC-P | Use a concentration of 5 - 20 µg/ml. |
Target
-
Function
Conversion of pregnenolone and progesterone to their 17-alpha-hydroxylated products and subsequently to dehydroepiandrosterone (DHEA) and androstenedione. Catalyzes both the 17-alpha-hydroxylation and the 17,20-lyase reaction. Involved in sexual development during fetal life and at puberty. -
Pathway
Lipid metabolism; steroid biosynthesis. -
Involvement in disease
Defects in CYP17A1 are the cause of adrenal hyperplasia type 5 (AH5) [MIM:202110]. AH5 is a form of congenital adrenal hyperplasia, a common recessive disease due to defective synthesis of cortisol. Congenital adrenal hyperplasia is characterized by androgen excess leading to ambiguous genitalia in affected females, rapid somatic growth during childhood in both sexes with premature closure of the epiphyses and short adult stature. Four clinical types: "salt wasting" (SW, the most severe type), "simple virilizing" (SV, less severely affected patients), with normal aldosterone biosynthesis, "non-classic form" or late onset (NC or LOAH), and "cryptic" (asymptomatic). -
Sequence similarities
Belongs to the cytochrome P450 family. -
Post-translational
modificationsPhosphorylation is necessary for 17,20-lyase, but not for 17-alpha-hydroxylase activity. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 13074 Mouse
- Entrez Gene: 25146 Rat
- SwissProt: P27786 Mouse
- SwissProt: P11715 Rat
- Unigene: 1262 Mouse
- Unigene: 10172 Rat
-
Alternative names
- 20 lyase antibody
- CP17A_HUMAN antibody
- CPT7 antibody
see all
Images
-
Anti-Cytochrome P450 17A1/CYP17A1 antibody (ab231914) at 2 µg/ml + Rat testis lysate
Predicted band size: 58 kDa -
Anti-Cytochrome P450 17A1/CYP17A1 antibody (ab231914) at 2 µg/ml + Recombinant mouse Cytochrome P450 17A1/CYP17A1 protein
Predicted band size: 58 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Cytochrome P450 17A1/CYP17A1 antibody (ab231914)
Paraffin-embedded mouse testis tissue stained for Cytochrome P450 17A1/CYP17A1 using ab231914 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Cytochrome P450 17A1/CYP17A1 antibody (ab231914)
Formalin-fixed, paraffin-embedded mouse kidney tissue stained for Cytochrome P450 17A1/CYP17A1 using ab231914 at 20 µg/ml in immunohistochemical analysis. DAB staining.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab231914 has not yet been referenced specifically in any publications.