For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    cytochrome-p450-17a1cyp17a1-antibody-ab231914.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cardiovascular Lipids / Lipoproteins Lipid Metabolism Cytochromes
Share by email

Anti-Cytochrome P450 17A1/CYP17A1 antibody (ab231914)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-Cytochrome P450 17A1/CYP17A1 antibody (ab231914)
  • Western blot - Anti-Cytochrome P450 17A1/CYP17A1 antibody (ab231914)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Cytochrome P450 17A1/CYP17A1 antibody (ab231914)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Cytochrome P450 17A1/CYP17A1 antibody (ab231914)

Key features and details

  • Rabbit polyclonal to Cytochrome P450 17A1/CYP17A1
  • Suitable for: WB, IHC-P
  • Reacts with: Mouse, Rat
  • Isotype: IgG

You may also be interested in

Protein
Product image
Recombinant Human Cytochrome P450 17A1/CYP17A1 protein (ab152320)
Secondary
Product image
Goat Anti-Rabbit IgG H&L (HRP) (ab205718)

View more associated products

Overview

  • Product name

    Anti-Cytochrome P450 17A1/CYP17A1 antibody
    See all Cytochrome P450 17A1/CYP17A1 primary antibodies
  • Description

    Rabbit polyclonal to Cytochrome P450 17A1/CYP17A1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse Cytochrome P450 17A1/CYP17A1 aa 201-507. (Expressed in E.coli).
    Sequence:

    TEGIVDVLGHSDLVDIFPWLKIFPNKNLEMIKEHTKIREKTLVEMFEKCK EKFNSESLSSLTDILIQAKMNAENNNTGEGQDPSVFSDKHILVTVGDIFG AGIETTSSVLNWILAFLVHNPEVKRKIQKEIDQYVGFSRTPSFNDRTHLL MLEATIREVLRIRPVAPLLIPHKANIDSSIGEFAIPKDTHVIINLWALHH DKNEWDQPDRFMPERFLDPTGSHLITPTPSYLPFGAGPRSCIGEALARQE LFIFMALLLQRFDFDVSDDKQLPCLVGDPKVVFLIDPFKVKITVRQAWKD AQVEVST


    Database link: P27786
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • IHC-P: Mouse testis and kidney tissues. WB: Rat testis lysate; Recombinant mouse Cytochrome P450 17A1/CYP17A1 protein.
  • General notes

     This product was previously labelled as Cytochrome P450 17A1

     

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231914 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Cardiovascular
    • Lipids / Lipoproteins
    • Lipid Metabolism
    • Cytochromes
    • Signal Transduction
    • Growth Factors/Hormones
    • Hormones
    • Signal Transduction
    • Metabolism
    • Lipid metabolism
    • Cancer
    • Growth factors
    • Hormones
    • Cancer
    • Cancer Metabolism
    • Metabolic signaling pathway
    • Metabolism of lipids and lipoproteins
    • Cancer
    • Cancer Metabolism
    • Metabolic signaling pathway
    • Hormone biosynthesis
    • Metabolism
    • Pathways and Processes
    • Metabolic signaling pathways
    • Lipid and lipoprotein metabolism
    • Lipid metabolism
    • Metabolism
    • Pathways and Processes
    • Metabolic signaling pathways
    • Lipid and lipoprotein metabolism
    • Lipases
    • Metabolism
    • Pathways and Processes
    • Endocrine metabolism
    • Hormone biosynthesis
    • Metabolism
    • Pathways and Processes
    • Mitochondrial Metabolism
    • Cytochromes

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)
  • Recombinant Protein

    • Recombinant Human Cytochrome P450 17A1/CYP17A1 protein (ab152320)

Applications

Our Abpromise guarantee covers the use of ab231914 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 58 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Conversion of pregnenolone and progesterone to their 17-alpha-hydroxylated products and subsequently to dehydroepiandrosterone (DHEA) and androstenedione. Catalyzes both the 17-alpha-hydroxylation and the 17,20-lyase reaction. Involved in sexual development during fetal life and at puberty.
  • Pathway

    Lipid metabolism; steroid biosynthesis.
  • Involvement in disease

    Defects in CYP17A1 are the cause of adrenal hyperplasia type 5 (AH5) [MIM:202110]. AH5 is a form of congenital adrenal hyperplasia, a common recessive disease due to defective synthesis of cortisol. Congenital adrenal hyperplasia is characterized by androgen excess leading to ambiguous genitalia in affected females, rapid somatic growth during childhood in both sexes with premature closure of the epiphyses and short adult stature. Four clinical types: "salt wasting" (SW, the most severe type), "simple virilizing" (SV, less severely affected patients), with normal aldosterone biosynthesis, "non-classic form" or late onset (NC or LOAH), and "cryptic" (asymptomatic).
  • Sequence similarities

    Belongs to the cytochrome P450 family.
  • Post-translational
    modifications

    Phosphorylation is necessary for 17,20-lyase, but not for 17-alpha-hydroxylase activity.
  • Cellular localization

    Membrane.
  • Target information above from: UniProt accession P05093 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 13074 Mouse
    • Entrez Gene: 25146 Rat
    • SwissProt: P27786 Mouse
    • SwissProt: P11715 Rat
    • Unigene: 1262 Mouse
    • Unigene: 10172 Rat
    • Alternative names

      • 20 lyase antibody
      • CP17A_HUMAN antibody
      • CPT7 antibody
      • CYP17 antibody
      • CYP17A1 antibody
      • CYPXVII antibody
      • Cytochrome P450 17A1 antibody
      • Cytochrome P450 family 17 antibody
      • Cytochrome P450 family 17 subfamily A polypeptide 1 antibody
      • Cytochrome p450 subfamily XVII (steroid 17 alpha hydroxylase) adrenal hyperplasia antibody
      • Cytochrome p450 XVIIA1 antibody
      • Cytochrome P450-C17 antibody
      • Cytochrome P450c17 antibody
      • OTTHUMP00000020382 antibody
      • P450 C17 antibody
      • P450c17 antibody
      • S17AH antibody
      • Steroid 17 alpha hydroxylase/17,20 lyase antibody
      • Steroid 17 alpha monooxygenase antibody
      • Steroid 17-alpha-hydroxylase/17 antibody
      • Steroid 17-alpha-monooxygenase antibody
      see all

    Images

    • Western blot - Anti-Cytochrome P450 17A1/CYP17A1 antibody (ab231914)
      Western blot - Anti-Cytochrome P450 17A1/CYP17A1 antibody (ab231914)
      Anti-Cytochrome P450 17A1/CYP17A1 antibody (ab231914) at 2 µg/ml + Rat testis lysate

      Predicted band size: 58 kDa

    • Western blot - Anti-Cytochrome P450 17A1/CYP17A1 antibody (ab231914)
      Western blot - Anti-Cytochrome P450 17A1/CYP17A1 antibody (ab231914)
      Anti-Cytochrome P450 17A1/CYP17A1 antibody (ab231914) at 2 µg/ml + Recombinant mouse Cytochrome P450 17A1/CYP17A1 protein

      Predicted band size: 58 kDa

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Cytochrome P450 17A1/CYP17A1 antibody (ab231914)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Cytochrome P450 17A1/CYP17A1 antibody (ab231914)

      Paraffin-embedded mouse testis tissue stained for Cytochrome P450 17A1/CYP17A1 using ab231914 at 20 µg/ml in immunohistochemical analysis. DAB staining.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Cytochrome P450 17A1/CYP17A1 antibody (ab231914)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Cytochrome P450 17A1/CYP17A1 antibody (ab231914)

      Formalin-fixed, paraffin-embedded mouse kidney tissue stained for Cytochrome P450 17A1/CYP17A1 using ab231914 at 20 µg/ml in immunohistochemical analysis. DAB staining.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab231914? Please let us know so that we can cite the reference in this datasheet.

    ab231914 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab231914.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.