Overview

  • Product name

    Anti-Cytochrome P450 3A4/CYP3A4 antibody
    See all Cytochrome P450 3A4/CYP3A4 primary antibodies
  • Description

    Rabbit polyclonal to Cytochrome P450 3A4/CYP3A4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human, Pig
  • Immunogen

    Recombinant fragment corresponding to Human Cytochrome P450 3A4/CYP3A4 aa 344-497. Expressed in E.coli.
    Sequence:

    PPTYDTVLQMEYLDMVVNETLRLFPIAMRLERVCKKDVEINGMFIPKGVV VMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCI GMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKV ESRD


    Database link: P08684

  • Positive control

    • WB: Recombinant human Cytochrome P450 3A4/CYP3A4 protein; Porcine and rat liver tissue. IHC-P: Human liver tissue.
  • General notes

     This product was previously labelled as Cytochrome P450 3A4

     

Properties

Applications

Our Abpromise guarantee covers the use of ab231816 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It performs a variety of oxidation reactions (e.g. caffeine 8-oxidation, omeprazole sulphoxidation, midazolam 1'-hydroxylation and midazolam 4-hydroxylation) of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. The enzyme also hydroxylates etoposide.
  • Tissue specificity

    Expressed in prostate and liver. According to some authors, it is not expressed in brain (PubMed:19094056). According to others, weak levels of expression are measured in some brain locations (PubMed:19359404 and PubMed:18545703). Also expressed in epithelium of the small intestine and large intestine, bile duct, nasal mucosa, kidney, adrenal cortex, epithelium of the gastric mucosa with intestinal metaplasia, gallbladder, intercalated ducts of the pancreas, chief cells of the parathyroid and the corpus luteum of the ovary (at protein level).
  • Sequence similarities

    Belongs to the cytochrome P450 family.
  • Post-translational
    modifications

    Polyubiquitinated in the presence of AMFR and UBE2G1 and also STUB1/CHIP and UBE2D1 (in vitro).
  • Cellular localization

    Endoplasmic reticulum membrane. Microsome membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 1,8-cineole 2-exo-monooxygenase antibody
    • Albendazole monooxygenase antibody
    • Albendazole sulfoxidase antibody
    • CP33 antibody
    • CP34 antibody
    • CP3A4_HUMAN antibody
    • CYP3 antibody
    • CYP3A antibody
    • CYP3A3 antibody
    • CYP3A4 antibody
    • CYPIIIA3 antibody
    • CYPIIIA4 antibody
    • Cytochrome P450 3A3 antibody
    • Cytochrome P450 3A4 antibody
    • Cytochrome P450 family 3 subfamily A polypeptide 4 antibody
    • Cytochrome P450 HLp antibody
    • Cytochrome P450 NF-25 antibody
    • Cytochrome P450 subfamily IIIA polypeptide 4 antibody
    • cytochrome P450, subfamily IIIA (niphedipine oxidase), polypeptide 3 antibody
    • cytochrome P450, subfamily IIIA (niphedipine oxidase), polypeptide 4 antibody
    • Cytochrome P450-PCN1 antibody
    • Glucocorticoid inducible P450 antibody
    • HLP antibody
    • MGC126680 antibody
    • NF 25 antibody
    • NF25 antibody
    • Nifedipine oxidase antibody
    • P450 III steroid inducible antibody
    • P450 PCN1 antibody
    • P450, family III antibody
    • P450C3 antibody
    • P450PCN1 antibody
    • Quinine 3 monooxygenase antibody
    • Quinine 3-monooxygenase antibody
    • Taurochenodeoxycholate 6 alpha hydroxylase antibody
    • Taurochenodeoxycholate 6-alpha-hydroxylase antibody
    see all

Images

  • Recombinant human Cytochrome P450 3A4/CYP3A4

    Developed using the ECL technique.

    Observed band size: 22 kDa
    why is the actual band size different from the predicted?

  • All lanes : Anti-Cytochrome P450 3A4/CYP3A4 antibody (ab231816) at 2 µg/ml

    Lane 1 : Porcine liver tissue lysate
    Lane 2 : Rat liver tissue lysate

    Developed using the ECL technique.
  • Formalin-fixed, paraffin-embedded human liver tissue stained for Cytochrome P450 3A4/CYP3A4 using ab231816 at 20μg/ml in immunohistochemical analysis. DAB staining.

References

ab231816 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231816.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up