Overview

  • Product name

    Anti-Cytochrome P450 Reductase antibody
    See all Cytochrome P450 Reductase primary antibodies
  • Description

    Rabbit polyclonal to Cytochrome P450 Reductase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human, Pig
    Predicted to work with: Rabbit, Guinea pig, Cow
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human Cytochrome P450 Reductase aa 77-518. Expressed in E.coli. N-terminal tag.
    Sequence:

    GRNIIVFYGSQTGTAEEFANRLSKDAHRYGMRGMSADPEEYDLADLSSLP EIDNALVVFCMATYGEGDPTDNAQDFYDWLQETDVDLSGVKFAVFGLGNK TYEHFNAMGKYVDKRLEQLGAQRIFELGLGDDDGNLEEDFITWREQFWPA VCEHFGVEATGEESSIRQYELVVHTDIDAAKVYMGEMGRLKSYENQKPPF DAKNPFLAAVTTNRKLNQGTERHLMHLELDISDSKIRYESGDHVAVYPAN DSALVNQLGKILGADLDVVMSLNNLDEESNKKHPFPCPTSYRTALTYYLD ITNPPRTNVLYELAQYASEPSEQELLRKMASSSGEGKELYLSWVVEARRH ILAILQDCPSLRPPIDHLCELLPRLQARYYSIASSSKVHPNSVHICAVVV EYETKAGRINKGVATNWLRAKEPAGENGGRALVPMFVRKSQF


    Database link: P16435

  • Positive control

    • WB: Recombinant human Cytochrome P450 Reductase protein; Pig liver lysate; Mouse large intestine lysate; Rat stomach and liver lysate. IHC-P: Human cerebrum, liver, kidney, colorectal cancer, lung cancer and stomach tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab232788 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 77 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    This enzyme is required for electron transfer from NADP to cytochrome P450 in microsomes. It can also provide electron transfer to heme oxygenase and cytochrome B5.
  • Involvement in disease

    Defects in POR are the cause of adrenal hyperplasia variant type (AHV) [MIM:201750]; also known as Antley-Bixler syndrome-like phenotype with disordered steroidogenesis. AHV is a rare variant of congenital adrenal hyperplasia. It is an autosomal recessive disorder with apparent combined P450C17 and P450C21 deficiency. Affected girls are born with ambiguous genitalia, but their circulating androgens are low and virilization does not progress. Conversely, affected boys are sometimes born undermasculinized. Boys and girls can also present with bone malformations, in some cases resembling the pattern seen in patients with Antley-Bixler syndrome.
    Defects in POR are a cause of isolated disordered steroidogenesis (IDS) [MIM:201750].
  • Sequence similarities

    In the C-terminal section; belongs to the flavoprotein pyridine nucleotide cytochrome reductase family.
    Contains 1 FAD-binding FR-type domain.
    Contains 1 flavodoxin-like domain.
  • Cellular localization

    Endoplasmic reticulum membrane. Anchored to the ER membrane by its N-terminal hydrophobic region.
  • Information by UniProt
  • Database links

  • Alternative names

    • CPR antibody
    • CYPOR antibody
    • Cytochrome p450 oxidoreductase antibody
    • DKFZp686G04235 antibody
    • FLJ26468 antibody
    • NADPH Cytochrome P450 Reductase antibody
    • NADPH dependent cytochrome P450 reductase antibody
    • NADPH--cytochrome P450 reductase antibody
    • NCPR_HUMAN antibody
    • P450 (cytochrome) oxidoreductase antibody
    • P450 Cytochrome Oxidoreductase antibody
    • P450R antibody
    • por antibody
    see all

Images

  • All lanes : Anti-Cytochrome P450 Reductase antibody (ab232788) at 1 µg/ml

    Lane 1 : Pig liver lysate
    Lane 2 : Mouse large intestine lysate
    Lane 3 : Rat stomach lysate
    Lane 4 : Rat liver lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 77 kDa

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for Cytochrome P450 Reductase using ab232788 at 30 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human cerebrum tissue stained for Cytochrome P450 Reductase using ab232788 at 30 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver tissue stained for Cytochrome P450 Reductase using ab232788 at 30 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for Cytochrome P450 Reductase using ab232788 at 30 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human colorectal cancer tissue stained for Cytochrome P450 Reductase using ab232788 at 30 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human lung cancer tissue stained for Cytochrome P450 Reductase using ab232788 at 30 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Anti-Cytochrome P450 Reductase antibody (ab232788) at 1 µg/ml + Recombinant human Cytochrome P450 Reductase protein

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 77 kDa

References

ab232788 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232788.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up