Anti-Cytokeratin 10 antibody (ab230801)
Key features and details
- Rabbit polyclonal to Cytokeratin 10
- Suitable for: Flow Cyt, IHC-P, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Cytokeratin 10 antibody
See all Cytokeratin 10 primary antibodies -
Description
Rabbit polyclonal to Cytokeratin 10 -
Host species
Rabbit -
Tested applications
Suitable for: Flow Cyt, IHC-P, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Cow, Dog -
Immunogen
Synthetic peptide corresponding to Human Cytokeratin 10 aa 150-179 conjugated to keyhole limpet haemocyanin.
Sequence:MQNLNDRLASYLDKVRALEESNYELEGKIK
Database link: P13645 -
Positive control
- WB: HEK-293 cell lysate. IHC-P: Human skin tissue. Flow Cytometry: HEK-293 cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituent: PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab230801 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
Flow Cyt | 1/10 - 1/50. | |
IHC-P | 1/100 - 1/200. Perform heat mediated antigen retrieval before commencing with IHC staining protocol. | |
WB | 1/1000. Predicted molecular weight: 59 kDa. |
Target
-
Tissue specificity
Seen in all suprabasal cell layers including stratum corneum. -
Involvement in disease
Defects in KRT10 are a cause of bullous congenital ichthyosiform erythroderma (BCIE) [MIM:113800]; also known as epidermolytic hyperkeratosis (EHK) or bullous erythroderma ichthyosiformis congenita of Brocq. BCIE is an autosomal dominant skin disorder characterized by widespread blistering and an ichthyotic erythroderma at birth that persist into adulthood. Histologically there is a diffuse epidermolytic degeneration in the lower spinous layer of the epidermis. Within a few weeks from birth, erythroderma and blister formation diminish and hyperkeratoses develop.
Defects in KRT10 are a cause of ichthyosis annular epidermolytic (AEI) [MIM:607602]; also known as cyclic ichthyosis with epidermolytic hyperkeratosis. AEI is a skin disorder resembling bullous congenital ichthyosiform erythroderma. Affected individuals present with bullous ichthyosis in early childhood and hyperkeratotic lichenified plaques in the flexural areas and extensor surfaces at later ages. The feature that distinguishes AEI from BCIE is dramatic episodes of flares of annular polycyclic plaques with scale, which coalesce to involve most of the body surface and can persist for several weeks or even months. -
Sequence similarities
Belongs to the intermediate filament family. - Information by UniProt
-
Database links
- Entrez Gene: 281888 Cow
- Entrez Gene: 491006 Dog
- Entrez Gene: 3858 Human
- Entrez Gene: 16661 Mouse
- Entrez Gene: 450225 Rat
- Omim: 148080 Human
- SwissProt: P06394 Cow
- SwissProt: Q6EIZ0 Dog
see all -
Alternative names
- BCIE antibody
- BIE antibody
- CK 10 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Cytokeratin 10 antibody (ab230801)
Formalin-fixed, paraffin-embedded human skin tissue stained for Cytokeratin 10 with ab230801 at 1/100 dilution in immunohistochemical analysis.
-
Anti-Cytokeratin 10 antibody (ab230801) at 1/1000 dilution + HEK-293 (human epithelial cell line from embryonic kidney) cell lysate at 35 µg
Developed using the ECL technique.
Predicted band size: 59 kDa -
Flow cytometric analysis of HEK-293 (human epithelial cell line from embryonic kidney) cells labeling Cytokeratin 10 with ab230801 at 1/10 dilution (green) compared with a negative control (blue).
FITC-conjugated goat-anti-rabbit secondary antibodies were used for the analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab230801 has not yet been referenced specifically in any publications.