Overview

  • Product name

    Anti-Cytokeratin 10 antibody [KRT10/1948R]
    See all Cytokeratin 10 primary antibodies
  • Description

    Rabbit monoclonal [KRT10/1948R] to Cytokeratin 10
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Cat, Dog, Human
  • Immunogen

    Recombinant full length protein corresponding to Human Cytokeratin 10.
    Sequence:

    MSVRYSSSKHYSSSRSGGGGGGGGCGGGGGVSSLRISSSKGSLGGGFSSG GFSGGSFSRGSSGGGCFGGSSGGYGGLGGFGGGSFRGSYGSSSFGGSYGG IFGGGSFGGGSFGGGSFGGGGFGGGGFGGGFGGGFGGDGGLLSGNEKVTM LASYLDKVRALEESNYELEGKIKEWYEKHGNSHQGEPRDYSKYYKTIDDL KNQILNLTTDNANILLQIDNARLAADDFRLKYENEVALRQSVEADINGLR RVLDELTLTKADLEMQIESLTEELAYLKKNHEEEMKDLRNVSTGDVNVEM NAAPGVDLTQLLNNMRSQYEQLAEQNRKDAEAWFNEKSKELTTEIDNNIE QISSYKSEITELRRNVQALEIELQSQLALKQSLEASLAETEGRYCVQLSQ IQAQISALEEQLQQIRAETECQNTEYQQLLDIKIRLENEIQTYRSLLEGE GSSGGGGRGGGSFGGGYGGGSSGGGSSGGGHGGGHGGSSGGGYGGGSSGG GSSGGGYGGGSSSGGHGGSSSGGYGGGSSGGGGGGYGGGSSGGGSSSGGG YGGGSSSGGHKSSSSGSVGESSSKGPRY


    Database link: P13645

  • Positive control

    • IHC-P: Human skin tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituents: PBS, 0.05% BSA
  • Concentration information loading...
  • Purity

    Protein A/G purified
  • Purification notes

    Purified from Bioreactor Concentrate by Protein A/G.
  • Clonality

    Monoclonal
  • Clone number

    KRT10/1948R
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab234313 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 0.1 - 2 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Primary incubation for 30 minutes at room temperature.

Target

  • Tissue specificity

    Seen in all suprabasal cell layers including stratum corneum.
  • Involvement in disease

    Defects in KRT10 are a cause of bullous congenital ichthyosiform erythroderma (BCIE) [MIM:113800]; also known as epidermolytic hyperkeratosis (EHK) or bullous erythroderma ichthyosiformis congenita of Brocq. BCIE is an autosomal dominant skin disorder characterized by widespread blistering and an ichthyotic erythroderma at birth that persist into adulthood. Histologically there is a diffuse epidermolytic degeneration in the lower spinous layer of the epidermis. Within a few weeks from birth, erythroderma and blister formation diminish and hyperkeratoses develop.
    Defects in KRT10 are a cause of ichthyosis annular epidermolytic (AEI) [MIM:607602]; also known as cyclic ichthyosis with epidermolytic hyperkeratosis. AEI is a skin disorder resembling bullous congenital ichthyosiform erythroderma. Affected individuals present with bullous ichthyosis in early childhood and hyperkeratotic lichenified plaques in the flexural areas and extensor surfaces at later ages. The feature that distinguishes AEI from BCIE is dramatic episodes of flares of annular polycyclic plaques with scale, which coalesce to involve most of the body surface and can persist for several weeks or even months.
  • Sequence similarities

    Belongs to the intermediate filament family.
  • Information by UniProt
  • Database links

  • Alternative names

    • BCIE antibody
    • BIE antibody
    • CK 10 antibody
    • CK-10 antibody
    • Cytokeratin-10 antibody
    • EHK antibody
    • K10 antibody
    • K1C10_HUMAN antibody
    • Keratin 10 antibody
    • Keratin 10 type I antibody
    • Keratin antibody
    • Keratin type i cytoskeletal 10 antibody
    • Keratin type I cytoskeletal 59 kDa antibody
    • Keratin-10 antibody
    • Keratin10 antibody
    • KPP antibody
    • KRT10 antibody
    • type I cytoskeletal 10 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human skin tissue stained for Cytokeratin 10 using ab234313 at 0.2 μg/ml in immunohistochemical analysis.

References

ab234313 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234313.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up