Overview

  • Product name

    Anti-Cytokeratin 13 antibody
    See all Cytokeratin 13 primary antibodies
  • Description

    Rabbit polyclonal to Cytokeratin 13
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human Cytokeratin 13 aa 104-403. (Expressed in E.coli).
    Sequence:

    EKITMQNLNDRLASYLEKVRALEEANADLEVKIRDWHLKQSPASPERDYS PYYKTIEELRDKILTATIENNRVILEIDNARLAADDFRLKYENELALRQS VEADINGLRRVLDELTLSKTDLEMQIESLNEELAYMKKNHEEEMKEFSNQ VVGQVNVEMDATPGIDLTRVLAEMREQYEAMAERNRRDAEEWFHTKSAEL NKEVSTNTAMIQTSKTEITELRRTLQGLEIELQSQLSMKAGLENTVAETE CRYALQLQQIQGLISSIEAQLSELRSEMECQNQEYKMLLDIKTRLEQEIA


    Database link: P13646

  • Positive control

    • WB: Human lung lysate; Pig spleen lysate; A431 cell lysate; Recombinant human Cytokeratin 13 protein. IHC-P: Human esophagus tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab232742 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 50 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Tissue specificity

    Expressed in some epidermal sweat gland ducts (at protein level) and in exocervix, esophagus and placenta.
  • Involvement in disease

    Defects in KRT13 are a cause of white sponge nevus of cannon (WSN) [MIM:193900]. WSN is a rare autosomal dominant disorder which predominantly affects non-cornified stratified squamous epithelia. Clinically, it is characterized by the presence of soft, white, and spongy plaques in the oral mucosa. The characteristic histopathologic features are epithelial thickening, parakeratosis, and vacuolization of the suprabasal layer of oral epithelial keratinocytes. Less frequently the mucous membranes of the nose, esophagus, genitalia and rectum are involved.
  • Sequence similarities

    Belongs to the intermediate filament family.
  • Post-translational
    modifications

    O-glycosylated; glycans consist of single N-acetylglucosamine residues.
  • Information by UniProt
  • Database links

  • Alternative names

    • 47 kDa cytokeratin antibody
    • CK-13 antibody
    • CK13 antibody
    • Cytokeratin 13 antibody
    • Cytokeratin-13 antibody
    • K13 antibody
    • K1C13_HUMAN antibody
    • Ka13 antibody
    • Keratin 13 antibody
    • Keratin antibody
    • keratin type I cytoskeletal 13 antibody
    • Keratin-13 antibody
    • Krt-1.13 antibody
    • Krt1-13 antibody
    • KRT13 antibody
    • MGC161462 antibody
    • MGC3781 antibody
    • type I cytoskeletal 13 antibody
    • Type I keratin Ka13 antibody
    • WSN2 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human esophagus tissue stained for Cytokeratin 13 using ab232742 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Anti-Cytokeratin 13 antibody (ab232742) at 2 µg/ml + Human lung lysate

    Predicted band size: 50 kDa

  • Anti-Cytokeratin 13 antibody (ab232742) at 2 µg/ml + A431 (Human epidermoid carcinoma cell line) cell lysate

    Predicted band size: 50 kDa

  • Anti-Cytokeratin 13 antibody (ab232742) at 2 µg/ml + Pig spleen lysate

    Predicted band size: 50 kDa

  • Anti-Cytokeratin 13 antibody (ab232742) at 2 µg/ml + Recombinant human Cytokeratin 13 protein

    Predicted band size: 50 kDa

References

ab232742 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232742.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up